KEGG   Bradymonas sediminis: DN745_14030Help
Entry
DN745_14030       CDS       T05497                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bsed  Bradymonas sediminis
Pathway
bsed00620  Pyruvate metabolism
bsed00680  Methane metabolism
bsed01100  Metabolic pathways
bsed01120  Microbial metabolism in diverse environments
bsed01200  Carbon metabolism
Module
bsed_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bsed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DN745_14030
  09102 Energy metabolism
   00680 Methane metabolism
    DN745_14030
Enzymes [BR:bsed01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DN745_14030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 AGOG HLH
Motif
Other DBs
NCBI-ProteinID: AWV90386
UniProt: A0A2Z4FNS2
LinkDB All DBs
Position
3726165..3728981
Genome map
AA seq 938 aa AA seqDB search
MTSFGQEEKPRLTEDLRTQVDLLGRALGDAIKEHYGETTYELVESLRSWAQRTDAGEELF
RQVAKLSLPEIENIIRSYTSYFHLANKAEQLEIARINRKREFEATVENPRSESIAQGVES
MRQAGWSDAELTDFLKELRIEPTLTAHPTEARRETLLNIQQRIAGHLKKMAAQTQTPAEA
KRIEEALRSEVALMLLSDQIRTERKTVDDEVDFGLYFLATTIWDAVPKIQRDLQRALSER
SEGDNFDQATELPALFRYSSWIGGDRDGNPNVTVDTTRNTFEKQRRVALKKYIKSLRLLR
QELSVSEVHVTLCDALFESLAEDKKSVKLSKADTRLVERDYAHEPFRRKLTYMLAKLNMA
IDQGAAPTHFARGAAASTAAPEERYRAEQFQDELKLIGKALHQAGLSHLANGRLTDLLAQ
VATFGFRLASLDFRQHSRVHEAAVSELLAIAGVASDYMGMPEEARLELLNQELQNPRPLR
PRGHVELSEQTRDLLEVFEVARQALEEDPGAVRAWVISMTHELSDLLEVLLLAKESGLWV
HRPGERGYAPIEIVPLLETIEDLAHVDTFMAKLFENPAYAAQLDGRERFQEVMVGYSDSS
KDGGYWMANWSQHKAQRALGEVSAKYNVQLCMFHGRGGTVGRGGGHSTRAIVGIPPQSYS
GRIRFTEQGEVISFRYSLEPIAHRHLEQLVHAMAQAAQGARDYRAGDAKNTARDQAMEAV
AARSMRVYRELIDDPEFWPWYQRVTPIEHISRLPIASRPSSRSGPAGPTFDSLRAIPWNF
AWTQTRYNTPGWYGMGTGLEEAVEANEINLEDLRDWYKNWSYFQGIIDNAQLEMARARLA
VSRQYCENLAEDMAFHERLEKEFELTRKWLLKITETDELLSKNNTIRQLIAVRNPYTDVL
NALQIELMTRWQKADCADLGHALLLSLNGVAAAMQNTG
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgacgagctttggacaagaggaaaaaccgcgactcaccgaggacttgcgcacgcaggtc
gacctgttgggccgcgcgttgggcgacgccattaaggagcactacggcgaaacaacctat
gagttggtggaatctctgcgaagttgggcgcaacgcaccgacgccggagaggaactcttt
cgccaggtcgccaagctctcgctgcccgaaatcgaaaatatcatccgcagctataccagc
tattttcacctggccaataaagccgagcagctcgagatcgcgcgcatcaaccgcaagcgc
gaattcgaggccactgtcgagaacccgcgctcggagtccatcgcccagggcgtcgagtcg
atgcgccaggcgggctggagtgacgcggagctcaccgacttcctaaaagagctgcgcatc
gagcccaccctcaccgcccaccccaccgaggctcgccgcgagacgttgctcaacatccag
cagcgcatcgccgggcacctcaagaagatggcggcgcagactcagacgccggcggaggcc
aaacgcatcgaagaggccctgcgcagcgaagtcgcgctgatgctccttagcgaccagatt
cgcaccgaacgaaagaccgtcgacgacgaagtcgacttcggcctgtactttctggcgacc
acgatctgggacgcggtccctaaaattcaacgcgacctgcagcgcgcgctcagcgagcga
tctgagggtgataatttcgaccaggccaccgagcttccggcgctgtttcgctactcctcc
tggatcggcggcgaccgcgacggcaacccgaacgtcacggtcgacacgacccgcaacacc
ttcgagaagcagcggcgcgtggcgctcaaaaaatatatcaaatcgctgcgcctgctgcgc
caggagcttagcgtctccgaggtccacgtcacgctttgcgacgccctcttcgagtcgctc
gccgaggacaaaaagagcgtcaagctcagcaaggccgacacgcgtctggtcgagcgcgat
tatgcccatgagccgttccgccggaagctgacctatatgctggccaagttgaatatggcc
atcgaccagggcgcggccccgacgcattttgcccgcggcgcggcggcttcgaccgctgca
cccgaggagcgctaccgcgcggagcaatttcaggacgagctcaagctcatcggaaaagcg
ctgcatcaggcgggtcttagccatctggccaacggtcgcctgaccgatcttctggcgcag
gtcgcgacctttggctttcgcctggcaagcctcgactttcgccagcatagccgcgtgcac
gaagccgcggtcagcgaattattggccatcgcgggcgttgcgtccgattatatgggaatg
cccgaagaggcgcggctggagctacttaatcaagagctgcagaacccgcgcccgctgcgc
ccgcgcggccatgttgagctcagcgagcaaacccgcgacttactcgaggtctttgaggtc
gcccgccaggccctcgaagaagatcccggcgcggtgcgcgcctgggtcatcagcatgacc
cacgagctgagcgacctgctcgaggtgctcctgctggccaaggaatccgggctatgggtg
catcgccccggcgagcgtggctacgccccgatcgagatcgtgccgcttctggagaccatc
gaagacctggcccatgtcgatacattcatggcgaagctcttcgagaacccggcctacgcc
gcccaattggacgggcgcgagcgcttccaggaagtcatggtcggctactccgacagctcc
aaagacggcggctattggatggcgaattggtcccagcacaaggcacagcgtgccctgggc
gaagtcagcgccaaatataatgtgcaattatgtatgttccacgggcgcggcggcacggtc
gggcgaggcggcggacacagcacccgcgccatcgtcggcatcccgccgcagtcctattcg
gggcgcatccgcttcaccgaacagggcgaggtcatctccttccgctattcgctggagccc
atcgcccaccgccacctcgagcagctcgtgcacgcgatggcccaggcagcccagggcgcg
cgcgactaccgcgccggcgacgccaaaaacaccgcgcgcgaccaggccatggaggccgtg
gccgcccgctcaatgcgtgtctaccgcgagctcatcgacgaccctgaattctggccatgg
taccagcgcgtcaccccgatcgagcatatcagtcgcctgcccattgcctcgcgccccagc
tcgcgctccggccccgctggaccgaccttcgacagcctgcgcgccattccgtggaacttc
gcctggacccagacccgctataatactccgggttggtacggcatgggcacaggtctcgaa
gaagccgttgaggccaacgagatcaacctcgaagacctgcgcgattggtataagaattgg
agttatttccagggaattatcgacaacgcccagctcgaaatggcgcgcgcgcgcctggcg
gtctcgcgccaatactgcgagaacctcgccgaagatatggcgtttcacgagcgcctcgag
aaagagtttgagctcacccgaaaatggttgctcaagatcaccgaaaccgacgagttgctc
tccaagaataacacgattcgccagcttatcgcggtgcgaaacccctataccgatgtgctc
aacgccctgcagatcgagctgatgacccgctggcaaaaggccgactgcgccgacctgggc
cacgcgctgctcttaagcctcaacggcgtcgccgcggccatgcagaataccggctga

DBGET integrated database retrieval system