KEGG   Bradymonas sediminis: DN745_14450Help
Entry
DN745_14450       CDS       T05497                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bsed  Bradymonas sediminis
Pathway
bsed00010  Glycolysis / Gluconeogenesis
bsed00020  Citrate cycle (TCA cycle)
bsed00620  Pyruvate metabolism
bsed01100  Metabolic pathways
bsed01110  Biosynthesis of secondary metabolites
bsed01120  Microbial metabolism in diverse environments
bsed01130  Biosynthesis of antibiotics
bsed01200  Carbon metabolism
Module
bsed_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bsed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DN745_14450
   00020 Citrate cycle (TCA cycle)
    DN745_14450
   00620 Pyruvate metabolism
    DN745_14450
Enzymes [BR:bsed01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DN745_14450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Peptidase_M23 RnfC_N HlyD_3 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AWV90465
UniProt: A0A2Z4FP05
LinkDB All DBs
Position
complement(3830664..3831950)
Genome map
AA seq 428 aa AA seqDB search
MAEVITMLALSPTMDEGTLAEWTIKEGDVVEEGQVIAEVETDKATMEMESFFEGTLLKLL
VAAGDAVPVGDAMAIVGEAGEDISALLKELEGGGAAAPAQADEAPAEELPAEDAADDGAA
AAKPAKGGASDGRVKSSPLARRMAEDAGIELSEIEGSGPSGRVIKRDVEAAMESQGAKKA
APAPKAASAAASADGLAAGTQVPLSQMRKTIAKRLQSVWQSTPHFTLTMDIDMAAAMAKR
KEINAGLKAANINAKVSVNDMIVKACAVALQEYPAMNVSYQDDHLLQFDEVHVGVAVAIE
EGLITPTIRFANEKGLRKISEEVRELAGRAQDKKLKPEEYTGGTFTVSNLGMFGIDHFMA
IINPPQAGILACGAVKKTPVVNDDGELEVGTRMKVTLSCDHRAVDGATGAEFLTHVKRLL
ETPLLLMV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagttatcacgatgcttgcgttgagccccaccatggatgaggggaccctggcc
gagtggacgatcaaagagggcgacgtcgtcgaagaaggccaggtgatcgccgaggtcgag
accgacaaggcgaccatggagatggaatccttcttcgaggggacgctgcttaaattattg
gtggccgccggtgacgcggtgcccgtgggcgacgcgatggcgatcgttggcgaggcaggc
gaggatatctcggcgctgctcaaggagcttgagggtggtggcgcggcggcgccggcgcag
gctgacgaggcgcccgctgaagagttgcccgctgaagatgccgccgacgatggcgcagcg
gcggcgaagcccgccaaaggcggcgcgtctgatgggcgtgtgaagtcgagcccgttggcg
cggcgcatggccgaagacgccggcattgagctcagcgagattgaaggcagcgggccgtcg
ggtcgcgtgattaagcgcgacgtcgaggcggccatggagagccagggcgccaagaaggct
gcgccggcgcccaaggctgcgagcgctgccgcctcggccgacggcctggccgccgggacg
caggtcccgctgtcgcagatgcgcaagacgatcgccaagcgccttcaaagcgtgtggcaa
tcgacgccgcatttcacgctgaccatggatatcgacatggcggcggcgatggccaagcga
aaagaaatcaacgccgggctcaaggccgccaatatcaacgccaaggtctcggtcaacgat
atgatcgtcaaggcgtgcgcggtcgcgctgcaggagtacccggcgatgaacgtctcgtac
caagacgaccatctgctgcaatttgacgaggtgcatgtcggcgtggccgtggctatcgaa
gagggcctgattacgccgactatccgcttcgccaatgagaagggtctgcgcaagatctcc
gaagaggtccgtgagctcgccgggcgcgcgcaggataagaagcttaagcccgaagaatat
accggcggcaccttcacggtgagcaacctcggcatgttcggcatcgaccatttcatggcg
atcatcaacccgccccaggccggtattctggcgtgtggtgcggtcaagaagacgccggtg
gtcaacgacgacggcgagcttgaggtgggcacgcgcatgaaggtcacgctgtcgtgtgac
caccgcgcggtggacggcgccacgggcgctgaattcctcacccacgtcaagcgtttgctc
gagacgccgttgctgctgatggtatga

DBGET integrated database retrieval system