KEGG   Bradymonas sediminis: DN745_15050Help
Entry
DN745_15050       CDS       T05497                                 

Definition
(GenBank) hypothetical protein
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
bsed  Bradymonas sediminis
Pathway
bsed02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsed00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DN745_15050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsed01001]
    DN745_15050
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsed02022]
    DN745_15050
   02035 Bacterial motility proteins [BR:bsed02035]
    DN745_15050
Enzymes [BR:bsed01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     DN745_15050
Protein kinases [BR:bsed01001]
 Histidine kinases
  NtrC family
   DN745_15050
Two-component system [BR:bsed02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   DN745_15050
Bacterial motility proteins [BR:bsed02035]
 Pilus system
  Twitching motility proteins
   DN745_15050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS_4 PAS_9 PAS PAS_8 HATPase_c_5 HATPase_c_3 PAS_10 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AWV90573
UniProt: A0A2Z4FNQ1
LinkDB All DBs
Position
3998904..4000649
Genome map
AA seq 581 aa AA seqDB search
MSPSSRELPEISLRERLGVLLAFRVAIVTILLGGAVVTNASALSSLADPENLTFLSLIVG
TYLLTIVYAVGLRFVRNLKVLAVLQIAGDMLLTAILVIATGGLDSLFVFLFYITIINAAG
VAGRRTALLAATATAVVFIYLALGATQILVFPDIEVMRTQRTTGALLYEISLHISAAYLV
AILAGYLANRLGEVTGELERQHSNVVELRALNANILESLNSGLLTINTDDRIIFFNRAAE
DITGHTASEAYGNPLAKVFPELADRLGENPDMPRLESNYTRPGGDEICLGFSVSPLLNSQ
HQNAGRIVIFQDLSEVKKLELENKRAERLAAIGQLAASIAHEIRNPLASISGSVEMLESM
ADLDEDDAMLMRIIVREVDRLNHLITDFLDFSRPRPLNIVDTDLIKMTGEVIGLFQNKKS
DAHLQVDLEFPDDLDAAPAPVDREALRQILWNLLNNAREAMPDADGAGRIRVSIARTDAQ
TQWRISVEDNGPGIPAPQLERIFEPFFTTKETGTGLGLATIHRLIKQHDGRIHAAQSDDL
GGARFDIEFPVATSLSSPEPDLQGLADKSDNTNFERSADLF
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgagcccttcatcccgggaactccccgaaatatcgttgcgcgagcgactcggcgtgctc
ctcgcattccgcgtcgccatcgtcacgattctgctgggcggcgcggtcgtcaccaacgcc
tccgcgctctccagcctcgcagaccccgaaaacctcacatttttatcgctgatcgtaggc
acttatctgctcacgatcgtctacgccgtggggttgcgctttgtgcgaaacctcaaagta
ttggcggtcctgcaaatcgccggagacatgctgctcaccgcgattctggtgatcgccacc
ggcgggctcgatagcctcttcgtcttcctcttctatatcaccatcatcaacgcagccggc
gtcgccgggcgccgcaccgccctgctcgccgccaccgcgaccgccgtcgtcttcatctat
ttggccctcggcgccacccagatcctggtgttccctgatatcgaggtcatgcgtacccaa
cgcacaaccggcgcgctgctctacgaaataagcctccatatttcagccgcttacctcgtc
gccatcctcgccggctacctggccaatcgcctcggcgaggtcaccggagaattggagcgc
cagcattcaaatgtggtggaattgcgcgcgcttaacgccaatatcctcgagagcctcaac
agcggcctgctcaccatcaacaccgacgatcgcatcatcttttttaaccgcgccgccgaa
gatatcaccggccacacggcctccgaagcctacggcaacccgctcgccaaagtcttccct
gagctggccgataggctcggcgagaaccccgatatgccgcgtctcgagagcaactataca
cgcccgggtggcgacgaaatttgcctgggtttttcggtttcgccgctgctcaattcccag
catcaaaacgccgggcgtatcgttattttccaagaccttagcgaggtcaaaaagctcgaa
ctcgagaataaacgcgccgagcgcctggccgccatcggccaactcgcggcctccatcgct
cacgagattcgcaaccccctggcctcgatcagcggctcggtcgagatgctcgaatcgatg
gccgacctcgacgaagacgacgccatgctcatgcgcatcatcgtgcgcgaggtcgaccgc
ctaaaccacctcatcaccgacttcctcgacttcagccgccctcgcccgctcaatatcgtc
gacaccgatctcatcaagatgaccggcgaggttatcggcctctttcagaacaagaaatcc
gacgcccatttgcaggtcgatctggagttccccgacgacctcgacgccgccccggccccg
gtcgaccgtgaagcgctgcgccagatcctgtggaacctgctcaacaacgcccgcgaggcg
atgcccgacgccgacggcgccggccgtatccgcgtctccatcgcgcgaaccgacgcccaa
acccaatggcgcatcagcgtcgaagataacggccccggcatccccgccccccagctcgag
cgcatcttcgagcccttcttcaccaccaaggagaccggcaccggcctgggcctggcgacc
attcaccggctcataaaacagcacgacggccgcatccacgccgctcaatccgacgactta
ggcggcgcccgcttcgatatcgaatttccggtagcaacttcactaagttctccggagcca
gaccttcaaggtctggcagacaaatccgacaacaccaatttcgagcgttcagcagacttg
ttttga

DBGET integrated database retrieval system