KEGG   Bradymonas sediminis: DN745_16210Help
Entry
DN745_16210       CDS       T05497                                 

Definition
(GenBank) hypothetical protein
Organism
bsed  Bradymonas sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like MFS_2 Sugar_tr LacY_symp MFS_4
Motif
Other DBs
NCBI-ProteinID: AWV90775
UniProt: A0A2Z4FPU2
LinkDB All DBs
Position
complement(4298014..4299231)
Genome map
AA seq 405 aa AA seqDB search
MNTKSPVLRLFPVLLVNLIGFAISIPVLPALAYALDGTATDVGFLYAIQALGQLLMAPIW
GAISDRFGRKRTLIATFLTAAVFEVMTALTPALWLLYIVRFLVGMCAGNVATASALIADS
TDPQSRSKGMAVIGISFGIGFTIGAGLGAWISTFGASGPGPLATGLPFAIGACIYVIAAI
MGVFLLIEPTRDAAARRENRVKTGLASIAHHLKSRPVALMCGIFFSYSLAITIMEGTFFV
YANEIYGWEQKQVGMSFAAFGLLMALVQGGIGRISKKIGDRRMVGIGVLLVGVGLTVTPF
NHALWFLFVFLGLATVGRALVHPGILSMTSSLSPDPSQTGALMGVLQSFASLSRVVGPAI
GGLIFVHISHGAPFWLSGVLLLVTGAWWWKAGRVLMARDSASVGR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaaaaagcccggtgctgcgcctgttccccgtcctgctggtcaacctgatcggc
ttcgcgatctcgatcccggtgctccccgcgctggcctacgcgttggacggaaccgcgacc
gacgtcggtttcctctacgcaatccaggcgctcggccaactgctgatggcgccgatctgg
ggcgccatctcggaccgattcggccgaaaacgcaccctcatcgcgaccttcttgaccgcc
gcggtcttcgaggtgatgaccgccctgacccccgccctctggctgctctatatcgtgcgc
tttctggtgggcatgtgcgccggcaacgtcgccaccgccagcgcgctcatcgccgactcc
accgacccccaatcgcgaagcaagggcatggcggtcatcggcatcagcttcggcatcggc
tttacgatcggcgcggggctgggcgcctggatcagcaccttcggggcgtctggccccggc
ccgctggccaccggcctgccgtttgcgatcggcgcctgcatctacgtcatcgccgccatt
atgggcgtcttcttgttgatcgagcccacccgagacgccgccgcgcgccgcgaaaaccgc
gtcaagaccggcctcgcctcgatcgcccatcaccttaagagtcgcccggtcgcgctgatg
tgtggcatcttcttctcctattcgctcgccattaccatcatggaagggacgtttttcgtc
tacgccaacgagatctacggctgggagcaaaaacaggtcggcatgtcgttcgccgccttc
ggcctgctcatggccctggtgcagggcggcatcgggcgcatctccaaaaagatcggcgac
cgcaggatggtcggcatcggggtgttgctggtgggcgttggactcacggtgaccccgttc
aaccacgccctctggttcctcttcgtcttcttggggctcgccaccgtcggccgcgccctg
gtgcacccgggcatcctgtcgatgacctcaagcctgagccccgacccctcccagaccggc
gcgcttatgggggtcttgcaatccttcgcgagcctgtcgcgcgtcgtcggccccgccatc
ggcgggctgatcttcgtgcatatctcccacggcgccccgttctggctctcgggcgtgctc
ttgctcgtcaccggcgcctggtggtggaaggcggggcgcgtgttaatggcccgggactcg
gcctcagtcggccgatga

DBGET integrated database retrieval system