KEGG   Bradymonas sediminis: DN745_16875Help
Entry
DN745_16875       CDS       T05497                                 

Definition
(GenBank) TrkA family potassium uptake protein
  KO
K03499  trk system potassium uptake protein
Organism
bsed  Bradymonas sediminis
Brite
KEGG Orthology (KO) [BR:bsed00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsed02000]
    DN745_16875
Transporters [BR:bsed02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   DN745_16875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_N TrkA_C NAD_binding_2 F420_oxidored NAD_Gly3P_dh_N UDPG_MGDP_dh_N 3HCDH_N NAD_binding_7 Shikimate_DH PglD_N Epimerase FAD_binding_3 adh_short ApbA eIF-1a XdhC_C IlvN Pyr_redox_2 HI0933_like AlaDh_PNT_C NAD_binding_8 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AWV90904
UniProt: A0A2Z4FQI7
LinkDB All DBs
Position
4476296..4476949
Genome map
AA seq 217 aa AA seqDB search
MAGEFAVIGLGQFGMALAKNLADQGQSVLVIDNNMEHIEEIKGEVESAVCVDSTDENALY
GLRIEKISCCVVAIGANSLQASILTTALLSQMGVPRIIGRAVNALHARILHAVGATEVVD
PEQEMGLRLARRLSQPSIGEQLQLGSATLAEVETPQAFVGKNLIELELRKRFRVSVLAIR
RGDEVHVNPHATDEIEAQDILVLIGQPEAVKKIGSLA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtgaatttgcagtgatcgggttgggccaattcggcatggcgctggccaaaaat
ctggccgaccagggccaatcggtgctcgtcatcgacaataatatggagcatatcgaggag
attaagggcgaggttgagtccgcggtctgcgtcgattccaccgatgagaacgcgctctac
ggcctgcgcatcgagaagatctcctgctgcgtggtcgccatcggcgcgaactccctgcag
gcctcgatcctgaccaccgcgcttttgagccagatgggcgtgccgcgcatcatcgggcgc
gcggtcaacgccctgcacgcgcgcatcttacacgccgtgggggcgaccgaggtcgtcgat
cccgagcaggagatgggccttcgcctggcgcgccggctctcgcagccgagcatcggcgag
cagctgcaactgggcagcgcgacgctggccgaggtcgagacgccccaggcttttgtcggc
aaaaacctcatcgaattggagcttcgcaagcgctttcgggtgtcggtgctcgcgattcgg
cgcggcgacgaggtccacgtcaacccgcacgccaccgatgagattgaggcccaggatatt
ctggtgctcatcggccagcccgaggcggtcaagaagatcggctccctggcctga

DBGET integrated database retrieval system