KEGG   Burkholderia seminalis: WJ12_07440Help
Entry
WJ12_07440        CDS       T04851                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bsem  Burkholderia seminalis
Pathway
bsem00020  Citrate cycle (TCA cycle)
bsem00310  Lysine degradation
bsem00380  Tryptophan metabolism
bsem01100  Metabolic pathways
bsem01110  Biosynthesis of secondary metabolites
bsem01120  Microbial metabolism in diverse environments
bsem01130  Biosynthesis of antibiotics
bsem01200  Carbon metabolism
Module
bsem_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsem_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WJ12_07440
  09105 Amino acid metabolism
   00310 Lysine degradation
    WJ12_07440
   00380 Tryptophan metabolism
    WJ12_07440
Enzymes [BR:bsem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     WJ12_07440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AOJ24687
UniProt: A0A103KCM1
LinkDB All DBs
Position
1:1644382..1645659
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQVIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAAPAAQPAAATASSSAA
ASPAASKLLAEKGLSAGDVAGSGRDGRVTKGDALAAGSAPKVAPAAAPAKAAAAKPSLPE
VKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDLRNKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQMSLADIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtttcggaagcgaccatg
ctgcagtggaagaagaagccgggcgaagcagtcgcacaggacgaaatcctgatcgaactc
gagaccgacaaggtcgtgctcgaagtgccggcaccggcagcgggcgtgcttgcgcaagtg
ctgcagaacgacggtgacacggtggttgccgatcaagtgatcgcgacgatcgacaccgaa
gcgaaggcaggtgccgccgaagcagcggcgggcgccgccgaagtcaagccggccgccgcg
cctgctgcggctgcaccggcagcccagccggccgccgcgacggcatcgagctcggccgcc
gcatcgccggctgcatcgaagctgctggccgagaagggcctgtcggcgggcgacgtcgca
ggttcgggccgcgacggccgcgtcacgaagggcgacgcgctggccgcaggcagcgcaccg
aaggtcgctccggccgccgcaccggccaaggccgctgccgcgaagccgtcgctgccggaa
gtgaaggtgccggcgtcggcaacgacctggctgaacgaccgtccggagcaacgcgtgccg
atgtcgcgcctgcgtgcgcgtatcgccgagcgcctgctcgaatcgcagcagaccaacgcg
atcctgacgacgttcaacgaagtcaacatggctccggtcatggatctgcgcaacaagtac
aaggacaagttcgagaaggaacatggcgtgaagctcggcttcatgtcgttcttcgtgaag
gcggctgtccacgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggtaacgac
atcgtctaccacggctacttcgacatcggtatcgccgtcggctcgccgcgcggcctcgtg
gtgccgatcctgcgcaacgcggaccagatgagcctcgccgacatcgagaagaagatcgcc
gaattcggccagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggtacg
ttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccg
ccgcagtcggccatcctcggcgtgcacgcgacgaaggagcgtccggtcgtcgagaacggc
cagatcgtgatccgtccgatcaactacctggcgctgtcgtacgaccaccgcatcatcgac
ggtcgcgaagccgtgctgtcgctcgtcgcgatgaaggatgcgctggaagatccggcacgc
ctgctgctcgacctgtaa

DBGET integrated database retrieval system