KEGG   Burkholderia seminalis: WJ12_12690Help
Entry
WJ12_12690        CDS       T04851                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bsem  Burkholderia seminalis
Pathway
bsem00020  Citrate cycle (TCA cycle)
bsem00480  Glutathione metabolism
bsem01100  Metabolic pathways
bsem01110  Biosynthesis of secondary metabolites
bsem01120  Microbial metabolism in diverse environments
bsem01130  Biosynthesis of antibiotics
bsem01200  Carbon metabolism
bsem01210  2-Oxocarboxylic acid metabolism
bsem01230  Biosynthesis of amino acids
Module
bsem_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsem_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WJ12_12690
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    WJ12_12690
Enzymes [BR:bsem01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     WJ12_12690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AOJ25627
UniProt: A0A103K5P2
LinkDB All DBs
Position
1:complement(2805677..2806933)
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVAHAYK
GKRKIHWMEIFAGEKATKVYGPDVWLPDETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVQYFKGVPSPVREPQKIDMVIFRENSEDIYAGIEWAAGSEQAKKVIKF
LQDEMGVKKIRFPETSGIGVKPVSTEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GLFRDAGYALAQKEFGGELIDGGPWMRVKNPKTGNEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADTIIAAMEKSILQKRVTYDFARLMEGATQVSCSGFGEVLIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggaaggcggtgacaagatcaccgtcaacaaggac
ttctcgctcaacgtttccgatcagccgatcattccctatatcgaaggcgacggtacgggc
ttcgatatcacgccggtcatgatcaaggtcgtcgacgcggcggtcgcgcatgcctacaag
ggcaagcgcaagatccactggatggagatcttcgcgggcgagaaggcgacgaaggtgtac
ggtccggacgtgtggctgccggacgagacgctgcaggtgctgaaggaatacgtggtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcattcgttcgctgaacgtcgcgctg
cgccaggaactcgacctgtacgtgtgcctgcgcccggtccagtacttcaagggcgtgccg
tcgccggtgcgcgagccgcagaagatcgacatggtgatcttccgcgagaactcggaagac
atctacgcgggcatcgaatgggccgcgggttccgagcaggcgaagaaggtcatcaagttc
ctgcaggacgagatgggcgtgaagaagatccgcttcccggaaacctcggggatcggcgtc
aagcccgtgtcgacggaaggcaccgagcgtctcgtgcgcaaggcgatccagtacgcgatc
gacaacgatcgcaagtcggtcacgctggtgcacaagggcaacatcatgaagttcacggaa
ggcctgttccgtgacgccggttacgcgctggcccagaaggaattcggcggcgagctgatc
gacggcggcccgtggatgcgcgtgaagaacccgaagacgggcaacgagatcgtgatcaag
gattcgatcgccgacgcgttcctgcagcagatcctgctgcgcccggccgaatacgacgtg
atcgcgacgctgaacctgaacggcgactacatctccgacgcactggccgcgcaggtcggc
ggcatcgggatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaggcgacg
cacggcacggcgccgaagtacgcgggcaaggattacgtgaaccccggttccgagatcctg
tcggcggaaatgatgctgcgccacctcggctggacggaagcggccgacacgatcatcgcc
gcgatggagaagtcgatcctgcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggggcgacgcaggtgtcgtgctccggcttcggcgaagtgctgatcgagaacatgtaa

DBGET integrated database retrieval system