KEGG   Burkholderia seminalis: WJ12_13435Help
Entry
WJ12_13435        CDS       T04851                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bsem  Burkholderia seminalis
Pathway
bsem00564  Glycerophospholipid metabolism
bsem01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    WJ12_13435
Enzymes [BR:bsem01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     WJ12_13435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AOJ25768
UniProt: A0A118FPM2
LinkDB All DBs
Position
1:2965296..2966819
Genome map
AA seq 507 aa AA seqDB search
MIQPNRYDLLVVGGGINGAGIARDAAGRGLSVLLCEQDDLASHTSSSSTKLIHGGLRYLE
YNEFGLVRKALQERETLLRAAPHIMWPLRFVMPHMPNLRPAWLIRIGLFLYDHLAKRELL
PGSRGIDMRRHAAGAPLIDSIKRGFVYSDGWVDDARLVVLNAMDAKERGAEILTRTRLVS
AERRGDEWEARLQHADGSIQVVHARAIANAAGPWVGEVLHGALGRGAHHSVRLVKGSHII
TRRLFDHDHAYIFQNPDKRIIFAIPYEHDFTLIGTTDVEYTNDPAKVAIDRDETQYLCDS
INRYFKRKISPADVHWTYSGVRPLLEDENAANASAVTRDYRLELDDGAGAPLLSVFGGKI
TTFRKLAEEAGDMLCRALGRDAKTWTAGVALPGGDIADAKFDVFADAFAKRHPWLPAALA
RRYARAYGTRAERVIDGAKSLADLGAEIAPGIHEAELRYLRDAEWATCAQDVLWRRSKLG
LHVTPGTLDAVTAAVDAWFAAAHAPHA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtgatccaaccgaatcgctacgatctgctcgtcgtcggcggcggcatcaacggcgcgggc
atcgcgcgcgatgcggccggccgcggcctgtcggtcctgctctgcgagcaggacgacctc
gcgtcgcacacgtcgtcgtccagcacgaagctgattcacggcggcctgcgttacctcgaa
tacaacgagttcgggctggtgcgcaaggcgctgcaggagcgcgaaacgctgctgcgcgcg
gcgccgcacatcatgtggccgctgcgcttcgtgatgccgcacatgccgaacctgcgcccg
gcctggctgatccgcatcggcctgttcctctacgatcacctcgcgaaacgcgaactgctg
cccggctcgcgcggcatcgacatgcgccgccacgcggccggcgcgccgctgatcgactcg
atcaagcgcggtttcgtctattccgacggctgggtcgacgatgcgcgcctcgtcgtgctg
aacgcgatggatgcgaaggagcgcggcgccgagatcctgacgcgcacccggctcgtctcc
gccgaacgccgcggcgacgaatgggaagcgcggctgcagcacgccgacggctcgatccag
gtcgtgcatgcgcgcgcgatcgcgaacgcggccggcccgtgggtcggcgaagtgctgcac
ggcgcgctcggccgcggcgcgcatcacagcgtgcggctcgtgaagggcagccacatcatc
acgcgccgcctgttcgatcacgatcacgcatacatcttccagaacccggacaagcggatc
atcttcgcgattccgtacgagcacgacttcacgctgatcggcacgaccgacgtcgagtac
acgaacgatcccgcgaaggtcgcgatcgatcgcgacgagacgcagtacctgtgcgattcg
atcaaccgctacttcaagcgcaagatctcgccggccgacgtgcactggacctactcgggc
gtgcgcccgctactcgaggacgagaacgcggcgaacgcgtcggccgtcacgcgcgactat
cgcctcgagctggacgacggcgcgggcgccccgctgctgtcggtgttcggcggcaagatc
acgacgttccgcaagctcgcggaagaagccggcgacatgctgtgccgcgcgctcggccgc
gacgcgaaaacctggaccgccggcgtcgcgctgccgggcggcgacatcgcggacgcgaag
ttcgacgtattcgccgacgcgttcgcaaaacgccatccgtggctgcccgccgcgctcgcc
cgccgctatgcgcgtgcgtacggcacgcgcgccgagcgcgtgatcgacggcgcgaagtcg
ctcgccgacctcggcgccgaaatcgccccgggcatccacgaagccgaactgcgctacctg
cgcgacgccgaatgggcgacctgcgcgcaggacgtgctgtggcgccgctcgaagctcggc
ctgcacgtgacgccgggcacgctcgacgcggtgacggccgcggtcgacgcatggttcgcc
gccgcgcacgcgccgcacgcgtga

DBGET integrated database retrieval system