KEGG   Burkholderia seminalis: WJ12_16445Help
Entry
WJ12_16445        CDS       T04851                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bsem  Burkholderia seminalis
Pathway
bsem00061  Fatty acid biosynthesis
bsem00780  Biotin metabolism
bsem01100  Metabolic pathways
bsem01130  Biosynthesis of antibiotics
bsem01212  Fatty acid metabolism
Module
bsem_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    WJ12_16445
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    WJ12_16445
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    WJ12_16445
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsem01004]
    WJ12_16445
Enzymes [BR:bsem01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     WJ12_16445
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     WJ12_16445
Lipid biosynthesis proteins [BR:bsem01004]
 Fatty acid synthase
  Component type
   WJ12_16445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AOJ26535
UniProt: A0A103K3M7
LinkDB All DBs
Position
3:complement(121389..122150)
Genome map
AA seq 253 aa AA seqDB search
MTLRHKRGLVVGIANERSIAWGCARAFCRAGATLAVTWQSDKTLPHVEPLFAQLDAPIRM
PLDVGRPDQMAAVFDALAAQWGAIDFVLHSVAFAPKADLQGRVVDSSPEGFALAMDTSCH
SFIRMARLAEPLMTRGGSLMAMSYLGAEQVVANYGVMGPVKAALEASVRYLAAELGGAGI
RVNAISPGVLPTRAASGLPDFGRLLDDTARRAPLHHALDIDDVGAFCAFLASDGARAITG
GTHYVDSGMHMLG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgacattgcgacacaagcgggggctcgtcgtcggcatcgcgaacgagcggagcatcgcg
tggggatgcgcgcgcgcgttttgccgggcgggcgccacgctcgcggtgacctggcagtcg
gacaagaccttgccgcacgtcgagccgctgttcgcgcaactcgacgcgccgatccggatg
ccgctcgacgtcgggcggccggaccagatggcggcggtgttcgacgcgcttgcggcgcaa
tggggcgcgatcgacttcgtgctgcattcggtcgcgtttgcgccgaaggccgatctgcag
ggccgcgtggtcgacagttcgccggaagggttcgcgctcgcgatggatacctcgtgccac
tcgttcatccggatggcgaggctggccgagccgttgatgacgcgcggcgggagcctgatg
gcgatgagctatctcggcgcggagcaggtcgtcgcgaactacggggtgatggggccggtc
aaggccgcgctcgaggcgagcgtgcggtacctggcggccgaactcggcggcgcgggcatt
cgcgtcaacgcgatttcgccgggcgtgctgccgacgcgcgcggcgtcgggcctgccggac
ttcggccggctgcttgacgacaccgcgcgccgggcaccgctgcatcacgcgctcgacatc
gacgacgtcggtgcgttctgcgcgtttcttgccagcgacggcgcacgggcgatcacgggc
ggcacgcactatgtcgattccggtatgcacatgctcggttag

DBGET integrated database retrieval system