KEGG   Burkholderia seminalis: WJ12_16875Help
Entry
WJ12_16875        CDS       T04851                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bsem  Burkholderia seminalis
Pathway
bsem00500  Starch and sucrose metabolism
bsem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    WJ12_16875
Enzymes [BR:bsem01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     WJ12_16875
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     WJ12_16875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459
Motif
Other DBs
NCBI-ProteinID: AOJ27286
UniProt: A0A124Q9B2
LinkDB All DBs
Position
3:224707..228120
Genome map
AA seq 1137 aa AA seqDB search
MKREDSLDDVRRAQFPSLAPAGTPRRRRARRRAPALCTDDPLWYKDAIIYQVHVKSFYDS
NNDGIGDFPGLIAKLDYIAELGVDTIWLLPFYPSPRRDDGYDIADYRDVHPDYGTLADVR
RFIREAHARGIRVIAELVINHTSDQHPWFQRARRAKPGSAHRDYYVWSDTDTKYAGTRII
FLDTETSNWTHDPVAGQYYWHRFYSHQPDLNFDNPAVVREVIQVMRFWLDLGIDGLRLDA
VPYLVEREGTNNENLPETHAILKRIRATIDAEYPNRMLLAEANQWPEDVQEYFGNEDECH
MAFHFPLMPRIYMSIASEDRFPIVDIMRQTPALAPSNQWAVFLRNHDELTLEMVTDSERD
LLWQTYASDRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDELGMGDN
IHLGDRDGVRTPMQWSSDRNGGFSRADPELLVLPPVMGSLYGYDAINVEAQTRDPHSLLN
WTRRILATRRASQAFGRGTIRFLRPENRKVLAYLRELDGHEPVLCVANLSRASQAVELDL
SEFAGRVPIEMTSDSPFPPIGQLPYLLTFPPYGFLWFVLAEHGREPSWRQPHAEPLPEYV
TLVMRRGETRPDVAQLHALAHDALASWLARRRWFASKDRAIGDAWLNVVTPMPDEPFQYA
EAWVSASDGGVERYVVPLATAWGGETSQPLFAQLALARVRRGHTVGYLTDAFALPAFARG
MLRKLRDGATVPTADGGRLAFLPEEALAALDPGDDADIRWLAAEQSNSSLVIGDAIVLKL
VRKVAHGIHPEAEMSRHLTRIGYANTATLAGEVVHVDPDGTPHTVAILQRYVDNQGDAWT
RSFDFLRRAVDELALPAADDEETADADEAPDALLGYAAFAGIIGTRLGQLHVALAQPSGD
PAFAPEHATPDHVDGWCADAIASFERALDVLRTRLDTLDPAMRATADTLLASRDAAVQAL
GDLVPRTLDAQCLRIHGDFHLGQVLDVQGDALLIDFEGEPARPLAHRRAKSHPLRDVAGL
LRSLSYVSATAQFAIEKAPPQAAGRKRALFDRFGQAAADRFVDCYRTAADLAPARFVDPR
YADRLLALFLIDKASYELCYEAANRPDWLSVPVGGLAALVERLLGDGGPPDDDGDTR
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgaagattccctcgacgacgtgcgccgcgcgcaattcccgtcgctcgcgccg
gccggcacgccgcgccggcgtcgcgcgcgccgccgcgcccccgcgctctgcacggacgat
ccgctgtggtacaaggacgcgatcatctaccaggtgcacgtgaagtcgttctacgactcg
aacaacgacggcatcggcgatttccccggcctgatcgcgaagctcgactacatcgccgaa
ctgggcgtcgacacgatctggctgctgccgttctacccgtcgccgcgccgcgacgacggc
tacgacatcgccgactaccgcgacgtgcatcccgactacggcacgctcgccgacgtgcgg
cgcttcatccgcgaagcgcatgcgcgcggcattcgcgtgatcgccgagctcgtgatcaac
cacacgtcggatcagcatccgtggttccagcgcgcgcgccgcgcgaagccgggctccgcg
catcgcgactactacgtgtggtccgacaccgacacgaaatacgcgggcacgcggatcatc
ttcctcgacaccgaaacgtcgaactggacgcacgacccggtggccggccagtactactgg
catcgcttctactcgcaccagcccgacctgaacttcgacaacccggccgtggtgcgcgaa
gtgatccaggtgatgcgcttctggctcgacctcggcatcgacgggctgcggctcgacgcg
gtgccgtacctggtcgagcgcgaaggcacgaacaacgagaacctgcccgagacgcatgcg
atcctgaagcggatccgcgcgacgatcgacgccgaatacccgaaccggatgctgctcgcg
gaagcgaaccagtggccggaggacgtgcaggagtatttcggcaacgaggacgaatgccac
atggcgttccactttccgctgatgccgcgcatctacatgtcgatcgcgagcgaggaccgc
ttcccgatcgtcgacatcatgcgacagacgccggcgctcgcgccgagcaaccagtgggcc
gtgttcctgcgcaaccacgacgagctgacgctcgagatggtcaccgattcggagcgcgac
ctgctgtggcagacctatgcgagcgaccggcgcgcgcggctgaacctcggcatccggcgc
cggctcgcgccgctgatggagcgcgaccggcgccgcatcgagctgatcaactcgctgctg
ctgtcgatgcccggcacgccggtgatctactacggcgacgagctcgggatgggcgacaac
atccacctcggcgaccgcgacggcgtgcgcacgccgatgcaatggtcgtcggaccgcaac
ggcggcttctcgcgcgccgaccccgagctgctcgtgctgccgccggtcatgggctcgctg
tacggctacgacgcgatcaacgtcgaggcgcaaacgcgcgacccgcattcgctgctgaac
tggacgcggcgcattctcgcgacccgccgcgcctcgcaggcgttcgggcgcggcacgatc
cgcttcctgcggccggagaaccgcaaggtgctcgcgtacctgcgcgagctggacggtcac
gagccggtgctgtgcgtcgccaacctgtcgcgcgcgtcgcaggccgtcgagctcgacctg
tccgaattcgcgggccgcgtgccgatcgagatgacgtccgattcgccgtttccgccgatc
ggtcagctcccgtatctcctcacctttccgccgtacgggttcctgtggttcgtgctcgcc
gagcacggccgcgaaccgtcgtggcggcagccgcacgcggaaccgctgcccgaatacgtg
acgctcgtgatgcggcgcggcgaaacgcggccggacgtcgcgcagctgcacgcgctcgcg
cacgacgcgctcgcttcatggctcgcgcggcggcgctggttcgcgtcgaaggatcgcgcg
atcggcgacgcgtggctgaatgtcgtcacgccgatgccggacgagccgttccagtatgcg
gaggcgtgggtgtcggccagcgacggcggcgtcgaacgctacgtcgtgccgctcgccacc
gcatggggcggcgagacctcgcagccgctgttcgcgcagcttgcgctggcgcgcgtgcgg
cgcggccatacggtcgggtacctgaccgatgcgttcgcgctgccggcgttcgcgcgcggg
atgctgcgcaagctgcgcgacggcgcgacggtgccgaccgccgacggcggccggctcgcg
ttcctgccggaggaggcgctcgcggcgctcgatcccggcgacgacgcggacatccgctgg
ctcgcggccgagcagagcaacagctcgctcgtgatcggcgacgcgatcgtgctgaagctg
gtgcgcaaggtcgcgcacggcatccacccggaagcggaaatgagccggcatctgacgcgc
atcggctacgcgaacaccgcgacgctcgcgggcgaagtcgtgcacgtcgatccggacggc
acgccgcacacggtcgcgatcctgcaacgctacgtcgacaaccagggcgacgcgtggaca
cggtcgttcgacttcctgcggcgggcggtcgacgaactcgcgctgccggccgcggacgac
gaagaaacggccgacgcggacgaagcacccgatgcgctgctcggctacgcggcgttcgcg
ggcatcatcggcacgcggctcggccagttgcacgtcgcgctcgcacagccgtccggcgac
cccgcgttcgcaccggagcatgccacgcccgaccacgtcgacggctggtgcgcggacgcg
atcgcgtcgttcgagcgcgcgctcgacgtgctgcgcacgcggctcgatacgctcgacccc
gcgatgcgcgcgacggccgacacgctgctcgcgtcgcgcgacgccgccgtgcaggcgctc
ggcgacctcgtgccgcgcacgctcgacgcgcaatgcctgcggattcacggcgatttccat
ctcggccaggtgctcgacgtccagggcgacgcgctgctgatcgacttcgagggcgaaccg
gcgcgcccgctcgcgcaccgccgcgcgaaatcgcatccgctgcgcgacgtcgccggcctg
ctgcgttcgctgtcgtacgtgagcgcgaccgcgcagttcgcgatcgagaaagcgccgccg
caggcggccggccgcaagcgtgcgctgttcgaccgcttcggacaggcggccgccgaccgc
ttcgtcgactgctatcgcacggccgccgatctcgctcccgcgcgcttcgtcgatccgcgc
tatgccgaccgcctgctcgcgctgttcttgatcgacaaggcgtcgtacgagctgtgctac
gaagccgcgaaccggccggactggctgagcgtgccggtcggcgggctcgcggcgctcgtc
gaacgcctgctcggcgacggcggaccgcccgacgacgacggagacacgcgatga

DBGET integrated database retrieval system