KEGG   Burkholderia seminalis: WJ12_20750Help
Entry
WJ12_20750        CDS       T04851                                 

Definition
(GenBank) porin
Organism
bsem  Burkholderia seminalis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porin_4 Porin_1
Motif
Other DBs
NCBI-ProteinID: AOJ27393
UniProt: A0A103KH18
LinkDB All DBs
Position
2:complement(24066..25157)
Genome map
AA seq 363 aa AA seqDB search
MTKKTLLALAACTLPAAAFAQSSVTMFGLMDAGISYVSNQGGHGAAKFDDNIFFPNLLGF
EGKEDLGAGTRAIFRLVNQYSLGNGSIIGGGLFARTAYVGLQNDRYGTLTLGNQYEFMVD
SLAASGNEIAQDLVGLYGFRNGPFDKLALPNNPTGAFDWDRVAGSNRVANSVKYTSPSLS
GLTFGALYGFGNVAGSIGANNTVSVGASYDNGPFGAGAAYTNQKYGAVGGLPPTSVRNWG
AGLHYTVGTVTGKALFTTVHNAQNGAGAWSAEAGAAWHPSPAWVVGASYTYMKGNDTLDN
AHAHQFLAAVQYWLSKRTMVYVAGVHQRTGHGSNAQINGVMDADGASSGARQSIARIGFS
TRF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaaagaccttactggcactcgcggcctgcacgcttccggctgcggcgtttgca
cagagcagcgtgacgatgttcgggctgatggacgccggcatcagctatgtcagcaatcaa
ggcggccacggcgccgcgaaattcgacgacaacatcttctttccgaacctgctcggcttc
gagggcaaggaggatctcggtgcgggcacgcgcgcgatcttccggctcgtgaaccagtat
tcgctcggcaacggctcgatcatcggcggcgggctgttcgcgcgcaccgcctacgtcggg
ctgcagaacgaccggtacggcacgctgacgctgggcaaccagtacgagttcatggtcgat
tcgctggccgccagcggcaacgagatcgcgcaggatctcgtcggcctgtacggcttccgc
aacggaccgttcgacaagctcgcgctgccgaacaacccgacgggcgcgttcgactgggac
cgcgtcgcgggcagcaatcgcgtcgcgaattcggtcaagtacacgagcccgtcgctgtcg
ggcctgaccttcggtgcgctgtacggcttcgggaacgtcgcggggtcgatcggcgcgaac
aacacggtcagcgtcggtgcgagctacgacaacggcccgttcggcgcgggcgcggcctat
acgaaccagaaatacggcgccgtcggcggactgccgcccaccagcgtgcgcaactggggc
gcgggcctgcattacacggtcggcacggtcacggggaaggcgctcttcacgaccgtgcac
aacgcgcagaacggcgcgggcgcatggtcggccgaagccggggccgcatggcacccgtcg
cccgcctgggtcgtcggcgcgagctatacctacatgaagggcaacgacacgctcgacaac
gcgcatgcgcatcaattcctggccgccgtccagtactggctgtcgaagcgcacgatggtg
tatgtcgccggcgtgcatcagcgcaccggccacggcagcaacgcgcagatcaacggcgtg
atggatgcggacggcgcatcgagcggcgcccggcagtcgatcgcgcggatcgggttcagt
acgcggttctga

DBGET integrated database retrieval system