KEGG   Burkholderia seminalis: WJ12_20765Help
Entry
WJ12_20765        CDS       T04851                                 

Definition
(GenBank) MFS transporter
Organism
bsem  Burkholderia seminalis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr LacY_symp MFS_1_like DUF2417
Motif
Other DBs
NCBI-ProteinID: AOJ27396
UniProt: A0A103KH42
LinkDB All DBs
Position
2:complement(27158..28462)
Genome map
AA seq 434 aa AA seqDB search
MTSPSSSRSPWTYENRLLLILFMTFGFVFFDRLALSFLFPFMSAELHLTNTQLGMVSSAL
ALTWALSGAATGAWSDARGTRKPLLIAAVLGFSVCSALSGLVGGFASLIAFRALMGIAEG
PVLPLSQSLMVESSTPSRRGLNMGLLQGSAAGLLGAMIGPPVVIGIATAYGWREAFYVSC
IPGFLIAFCIWRWVREVPPGGARHVQADGTGAPAASGAAINRWALLKERNILLCVLISCF
FLTWFVVIISFAPVFLVESRHLSPSDMGIVMTCLGAAWVFWGFAVPAISDRIGRKPTMIV
FALIAAVCPLVMIHVGSVWALGALVFVTYTGLGCFTLFMATIPAETVPPRAIASALGLIM
GAGELIGGFVAPTVAGFAADKYGLQFAMWTSATGAILACVLSFGLVETAPAVLRKRALAG
AAASRLDTPNLGGR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacatccccgtcttcctcccggtccccctggacgtacgagaacaggctgctgctgatc
ctgttcatgacgttcggcttcgtcttcttcgaccgcctcgcgctgtcgttcctgttcccg
ttcatgtcggccgagctgcacctgacgaacacgcagctcggcatggtgtcgtccgcactg
gcgctcacgtgggcgctgtcgggcgccgcgaccggcgcatggtccgatgcgcgcggcacg
cgcaagccgctgctgatcgccgccgtgctcggcttttccgtgtgctcggcactctccggg
ctcgtcggcggcttcgcgagcctgatcgcgttccgcgcgctgatgggcattgcggaaggc
cccgtgctgccgctgtcgcaatcgctgatggtcgaaagctcgacgccgagccgccgcggc
ttgaacatgggcctgctgcagggttcggccgccggcctgctcggcgcgatgatcggcccg
ccggtcgtgatcggcatcgccaccgcgtacggctggcgcgaggcgttctacgtgtcgtgc
atcccgggcttcctgatcgcgttctgcatctggcgctgggtgcgcgaagtgccgcccggc
ggcgcgcggcacgtgcaggccgacggcaccggtgcgccggccgcgagcggcgcggcgatc
aaccgctgggcgctgctgaaggaacgcaacatcctgctctgcgtgctgatcagctgcttc
ttcctcacgtggttcgtcgtgatcatctcgttcgcgcccgtcttcctcgtggaaagccgc
cacctgtcgccgtccgacatgggcatcgtgatgacctgcctcggcgccgcgtgggtgttc
tggggcttcgcggtgccggcgatctccgaccggatcggccgcaagccgacgatgatcgtg
ttcgcgctgatcgcggccgtgtgcccgctggtgatgatccatgtcgggtcggtctgggcg
ctcggtgcgctcgtgttcgtcacctatacgggcctcggctgcttcacgctgttcatggcg
acgatcccggccgaaacggtgccgccgcgcgcgatcgccagcgcgctcgggctgatcatg
ggcgccggagagctgatcggcggcttcgtcgcgccgactgtcgcaggctttgccgcggac
aagtatggcctgcagttcgcgatgtggacgtcggcgaccggcgcgatcctcgcgtgcgtg
ctgtcgttcggcctcgtcgaaaccgcgccggccgtgctgcgcaagcgcgcgctcgccggt
gccgccgccagccgcctcgacacgccaaacctcggagggcgctga

DBGET integrated database retrieval system