KEGG   Burkholderia seminalis: WJ12_20775Help
Entry
WJ12_20775        CDS       T04851                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
bsem  Burkholderia seminalis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AraC_binding_2 HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: AOJ27398
LinkDB All DBs
Position
2:29191..30171
Genome map
AA seq 326 aa AA seqDB search
MTNSTVFSRTRGSTADVPARDRMAYWDAFNAATLVGLRCSSLSPAGLEVEKTDITLPGLG
IADISGQDHVIERSPALVRQLPKESLFACQILSGRAYFIQRDRCLLAEAGDVVVYDTRVP
YLFGFLTPMRQLLIDMPVTSFDERLDAELAALPLRIAPKPGAGAMLGATLRASVERFMKD
PVAHDAARFVEHTRTLIAELIDTEVNGAGASRASLSYLLTAKQYIATHLGEPELGPQAVA
DAVGLSLRHLGRLFAAEGESITQHIWSERLSHAHRELTDARLRKTSIGEIAFRWGFSSQA
HFSRAIRERYGASPMALRDAARAAGG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaattcgaccgttttttcacgcacgcgaggctcgacggccgacgtgccggcgcgc
gacaggatggcgtactgggatgcgttcaatgcggcgacgctggtcgggctgcgctgctcg
tcgctgtcgccggccgggctcgaggtcgagaagaccgacatcacgctgccgggcctcggc
atcgccgacatcagtggtcaggatcacgtgatcgagcgcagccccgcgctggtgcgccag
ttgccgaaggaatcgctgttcgcgtgccagatcctgagcgggcgcgcgtatttcatccag
cgcgaccggtgcctgctcgcggaagccggcgatgtcgtcgtctacgacacgcgcgtgccc
tatcttttcggattcctgacgccgatgcggcagctgctgatcgacatgccggtcacgtcg
ttcgacgagcggctcgacgcggagctggccgcgctgccgctgcggatcgcgccgaaaccg
ggcgcgggcgcgatgctcggcgcgacgttgcgcgcgagcgtcgagcgtttcatgaaggat
ccggtggcgcacgatgccgcgcggttcgtcgagcatacgcgtacgctgatcgcggaactc
atcgacacggaagtcaacggcgcgggcgcgtcgcgtgcgtcgctgtcgtacctgctgacc
gcgaagcagtacatcgcgacgcatctcggcgagccggaactcgggccacaggccgtcgcg
gacgcggtcgggctgtcgctgcggcatctgggccggctcttcgcggccgaaggcgagtcg
atcacgcagcacatctggtcggagcggctgtcgcacgcgcatcgcgagctgaccgacgcg
cggctgcgcaagacgagcatcggcgagatcgcgtttcgctgggggttttcgagccaggcg
cacttcagccgcgcgatccgcgagcgctacggcgcgtcgccgatggcgctgcgcgatgcg
gcgcgtgcggccgggggctga

DBGET integrated database retrieval system