KEGG   Burkholderia seminalis: WJ12_24365Help
Entry
WJ12_24365        CDS       T04851                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bsem  Burkholderia seminalis
Pathway
bsem00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    WJ12_24365
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsem02000]
    WJ12_24365
Enzymes [BR:bsem01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     WJ12_24365
Transporters [BR:bsem02000]
 Other Transporters
  Pores ion channels [TC:1]
   WJ12_24365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: AOJ28039
UniProt: A0A103KAW4
LinkDB All DBs
Position
2:complement(804094..804762)
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELDVPYEIVRYARDPKTMLAPPELRAIHPLGKSPVVTDDG
RTFAESGAIIEYLAERYGKGRLAPPPGTPERHDYTYWLHYAEGSAMPPLLLKLVALRIAQ
APMPFFARPIARKIADTLQSGFVDPQIARHLGHVDGALQRTGWFVGDSFSAADIQMSFPL
EAATARGGGNRYPAIARFLDAIHARPAYQRALERGGPYDLLK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgtccatcacctgaacaactcgcgctcgcagcgcgtgctctggctgctcgaa
gaactggatgtaccgtacgaaatcgtgcgctacgcgcgcgatccgaaaacgatgctcgcg
ccgcccgaactgcgcgcgatccatccgctcggcaagtcgccggtcgtcaccgacgacggc
cgcacgttcgccgaatcgggtgcgatcatcgagtacctcgccgaacgctacggcaaaggg
cgtctcgcgccgccacccggcacgcccgagcggcacgactacacgtactggctgcactac
gcggaagggtcggcgatgccgccgctgctgctcaagctcgtcgccttgcggatcgcccag
gcaccgatgccgttcttcgcgcggccgatcgcacgcaagatcgccgacacgctgcagtcg
ggcttcgtcgatccgcagatcgcgcggcatctcggccatgtcgacggcgcgctgcaacgc
accggctggttcgtcggcgacagcttcagcgcggccgacatccagatgagcttcccgctc
gaagccgcgaccgcacgcggcggcggcaaccggtatcccgcgatcgcgcgcttcctcgac
gcgatccacgcacggccggcgtaccagcgggcgctggagcgcggcggcccgtacgacctg
ctcaagtaa

DBGET integrated database retrieval system