KEGG   Burkholderia seminalis: WJ12_25895Help
Entry
WJ12_25895        CDS       T04851                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bsem  Burkholderia seminalis
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    WJ12_25895
Enzymes [BR:bsem01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     WJ12_25895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_binding_3 DAO HI0933_like Glutaredoxin K_oxygenase NAD_binding_8 Thi4 FAD_oxidored FMO-like
Motif
Other DBs
NCBI-ProteinID: AOJ28318
UniProt: A0A103KAF8
LinkDB All DBs
Position
2:complement(1146840..1148438)
Genome map
AA seq 532 aa AA seqDB search
MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELLALLNEIASLTDRVTVAERRDDAE
RKPSFSIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDYA
FETYFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQDEVESRQIMAVPTMFLNGAS
FGQGRSSVKEILAKLDTGAGERAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRADALIPGDVHQ
IRLANGAVLKARTIVLATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLIEFGAQLRADEVLQRKLRSLPNVTIVTQAQTSELTGDGSKL
NGLVYKDLRSGDTRRIDLEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDVAPAAAPQPQAEEAVAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaaccaactcaaagcgtacctcgaaaaaatcacgcgcccg
atcgaactcgtcgcttcgctcgacgacagcgcgaaatcgcaggaactgctggcgctgctg
aacgagattgcgtcgctgacggatcgcgtgaccgttgcggaacgccgcgacgacgccgag
cgcaagccgtcgttctcgatcggcgaacccggcaagccggccggcatccgcttcgccggc
atcccgatgggccatgaattcacgtcgctcgtgctcgcgttgctgcagacgggcggccac
ccgatcaagctcgacgacgacgtgatcgaacagatccgcgcgctcgacggcgattacgca
ttcgagacgtatttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgctgatcaacccgcgcatccgccacgtcgcgatcgacggcgcactgttccag
gatgaagtcgagtcgcgccagatcatggccgtgccgacgatgttcctgaacggcgcgtcg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgacacgggcgccggc
gaacgcgcggcgaagtcgctcgaaaacaagccggtgttcgacacgctgatcgtcggcggc
ggcccggcaggcgcggcagccgccatctactcggcgcgcaagggcatcgcgacgggcgtc
gtcgccgagcgtttcggcggccaggtgctcgacacgatggcgatcgagaacttcgtgtcg
gtgcaggaaaccgaagggccgaagttcgcgaccgcgctcgagcagcacgtgaagcagtac
gacgtcgacatcatggacgtgcagcgcgccgacgcgttgattccgggcgacgtgcaccag
atccgcctcgcgaacggcgcggtgctgaaggcgaggacgatcgtgctcgcgaccggcgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgagtaccgcaaccgcggtgtcgcgtac
tgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtggtcggcggcggc
aactcgggcgtcgaggccgcgatcgacctggccggcatcgtgaaggaagtcacgctgatc
gaattcggcgcgcaactgcgcgcggacgaagtgctgcagcgcaagctgcgcagcctgccg
aacgtgacgatcgtcacgcaggcgcagacgagcgagctgaccggcgacggcagcaagctg
aacgggctcgtctacaaggatctgcgctcgggcgacacgcggcgcatcgatctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaaagggacggtcgaactg
tcgaagcacggcgagatcgtcgtcgatgcgcgcggtgcgacgtcggtgccgggcgtgttc
gcggccggcgacgtgacgacggtgccgttcaagcagatcgtgatcgccgtgggtgaaggc
gcgaaggcgtcgctcggcgcgttcgaccacctgatccgccaggacgtggcgccggccgcc
gcaccgcagccgcaagcggaagaagcggtcgccgcataa

DBGET integrated database retrieval system