KEGG   Burkholderia seminalis: WJ12_26085
Entry
WJ12_26085        CDS       T04851                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bsem  Burkholderia seminalis
Pathway
bsem00440  Phosphonate and phosphinate metabolism
bsem00998  Biosynthesis of various secondary metabolites - part 2
bsem01100  Metabolic pathways
bsem01110  Biosynthesis of secondary metabolites
bsem01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    WJ12_26085
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    WJ12_26085
Enzymes [BR:bsem01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     WJ12_26085
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Other DBs
NCBI-ProteinID: AOJ28355
LinkDB
Position
2:complement(1194628..1196313)
AA seq 561 aa
MNAREPNFTESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIGGERQPLAEIDEFCGKIKAGKDSQTDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQATAREIHESETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKTHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAAERLTGDTVISYGDLLFRSYIVRDLAESEAE
FSVVVDSSLTETNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGTPHGRWIGLLNVR
GAGVERLKAMLATLQARPDFDTLDIPSLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRRA
GDFAHGQTPLSEPGAGNGGAQ
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttcaccgaatcgcgcagcgcgcgcctgcgccgcatgctc
gtcagcagcgacctcgaattcctgatggaagcgcacaacggcctgtccgcgcgcatcgtc
cgcgaagccggcttcaaggggatctgggcgtcgggcctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaagcgagctggacgcaggtcgtcgacgtgctcgaattcatggcc
gacgcgagcgatctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgaacagcgcggcatcgcgggcgtgtgcatcgaggac
aagcagttcccgaagacgaacagcttcatcggcggcgagcgccagccgctcgcggaaatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagaccgatcccgacttctcg
atcgtcgcgcgcgtcgaggcgctgatcgccggctggggcatggacgaggcgctgcgccgc
gcgaacgcgtatgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctgcagttcgcgcgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaatcatctgatccgcgcgtcggcatccgcgatgcaggcgaccgcgcgcgag
atccacgaaagcgaaacgctgatcaacgtcgaggaccgcgtggcatcggtcaacgagatc
ttccgcctgcaggacgccgacgagtactcggcggccgagcgtatctacctgtcgtcgtcg
tcgcgcgcgtcgaatgccgcgatcgtgctcgccgcgagccgcggcaagggcctcgaagcc
gtgaccgaagacaagccgaaggtcatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagacgcacggcgtgaacgacatcaccgtggttggcggctatcgc
gccgatgcgatcgatacgtcgggcatcaagctcgtcgtcaacgagcgccacgcgcagacc
ggcgagctcgcgtcgctcgcctgcgcggccgaacgcctgacgggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcgtgcgcgacctcgcggagagcgaggccgag
ttcagcgtggtggtcgattcgtcgctcaccgagaccaatcagagcgtgcgagacttcgcc
ctctgctcggccgccgacgatcgcggcctgttcggccagaagacctacctgcagcgcgtg
tcgagcgacgttgccgcgggcacgccgcacggccgctggatcggcctgctgaacgtgcgc
ggcgccggtgtcgagcgcctgaaggcgatgctcgcgacgctgcaggcgcgccctgatttc
gacacgctcgacattccgtcgctgctcaacgaactgatcgccgccggcgagaagatcgag
gtgcagtacgtgcacggccactggcgcggggtcaacgacctcgaggacttccgccgcgcg
ggcgacttcgcgcacggccagacgccgctgtccgaaccgggcgccggcaacgggggcgcg
caatga

DBGET integrated database retrieval system