KEGG   Burkholderia seminalis: WJ12_32820Help
Entry
WJ12_32820        CDS       T04851                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bsem  Burkholderia seminalis
Pathway
bsem00250  Alanine, aspartate and glutamate metabolism
bsem00410  beta-Alanine metabolism
bsem00640  Propanoate metabolism
bsem00650  Butanoate metabolism
bsem01100  Metabolic pathways
bsem01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    WJ12_32820
   00650 Butanoate metabolism
    WJ12_32820
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WJ12_32820
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WJ12_32820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsem01007]
    WJ12_32820
Enzymes [BR:bsem01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     WJ12_32820
Amino acid related enzymes [BR:bsem01007]
 Aminotransferase (transaminase)
  Class III
   WJ12_32820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOJ29545
UniProt: A0A103K8S6
LinkDB All DBs
Position
2:2768545..2769834
Genome map
AA seq 429 aa AA seqDB search
MTVKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRH
PKIVKAISDQLNSFTHTAYQIVPYASYVELAEKINDRAPGDFPKKTAFFTTGAEAVENAI
KIARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNALHGVT
TADSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIAD
EVQTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYA
GNPLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLTSLQADVPQIADVRGPGAMIAVEF
LKPGSGEPDAEFTKRVQTRALERGLLLLVCGVYSNVVRFLFPLTITQPVFDEALAILEEV
LKETVGVPA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaagaatgccgatctgcaggcccgcaagaacgccgccaccccgcgcggcgtc
ggcgtgatgtgcgatttctacgcagcccgcgccgagaacgcggaactgtgggatgtcgaa
ggccgtcgcttcatcgatttcgccgccggcatcgcggtgctgaacacgggccaccgccac
ccgaagatcgtcaaggcgatctcggatcaactgaacagcttcacgcacaccgcttaccag
atcgtcccgtacgcgtcgtacgtcgagctggccgagaagatcaacgaccgcgcgccgggc
gacttcccgaagaagaccgcattcttcacgaccggcgccgaagccgtcgagaacgcgatc
aagatcgcgcgggccgcgaccggccgcccgggcgtcatcgcgttctcgggcggcttccac
ggccgcacgatgatgggcatggcgctgaccggcaaggtcgccccgtacaagctgaacttc
ggcccgttcccgggcgacgtgttccacgcgccgtacccgaacgcgctgcacggcgtgacg
accgccgactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgc
gtcgccgcgatcatcttcgaaccggtccagggcgaaggcggcttcaacccggcgccggcc
gaattcgtgcgcgcgctgcgcaagatctgtaacgaacacggcatcctgctgatcgccgac
gaagtccagacgggcttcgcacgcaccggcaagctgttcgcgatgcagcactacgacgtg
ctggccgacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtc
gtcggccgtgcggacgtgatggacgcggcagcgcccggcggcctcggcggcacgtacgcg
ggcaacccgctggccgtcgcctcggcgcacgcggtgctcgagatcatcgacgaggaaaag
ctgtgcgaacgcgcgacgcagctcggcgacgtgctgaaggcgaagctgacgtcgctgcag
gccgacgtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgagttc
ctgaagccgggctcgggcgagccggatgccgaattcacgaagcgcgtgcagacgcgcgcg
ctcgagcgcggcctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtacgtttcctg
ttcccgctgacgatcacgcagcccgtgttcgacgaagcgctcgcgatcctcgaggaagtg
ctgaaggaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system