KEGG   Burkholderia seminalis: WJ12_33065Help
Entry
WJ12_33065        CDS       T04851                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
bsem  Burkholderia seminalis
Pathway
bsem00550  Peptidoglycan biosynthesis
bsem01100  Metabolic pathways
bsem01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    WJ12_33065
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    WJ12_33065
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bsem01003]
    WJ12_33065
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsem01011]
    WJ12_33065
Enzymes [BR:bsem01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     WJ12_33065
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     WJ12_33065
Glycosyltransferases [BR:bsem01003]
 Polysaccharide
  Bacterial polysaccharide
   WJ12_33065
Peptidoglycan biosynthesis and degradation proteins [BR:bsem01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   WJ12_33065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AOJ30008
UniProt: A0A103K971
LinkDB All DBs
Position
2:complement(2820298..2822418)
Genome map
AA seq 706 aa AA seqDB search
MTDHTANPSPPPAPPPRRGRVWRTLAGVLLGLTLACAGIGVWTINRIWTQLPSVEHLAVY
RPALPLRIFSRDGDLLAEYGVERREFVPLERIPPLMRHALLAAEDAKFYAHGAVDVGGLA
RATFANVVTGQPGQGGSTITMQVARNFYLTRDKVLSRKLAEILMAAKLEREYSKDKLLEL
YMNEIYLGERAYGFAAAANVYFGKPLDALSAGEAAVLAGLPKAPSAFNPVVNPARATARR
DYVLGRMHALGQLDDATYRAAVDAPIVLATTPPPGIVAAPYVAERARRMMVERFHDDAYT
LGLDVTTTISMRDQRAAEAALERTLNRQPRAKRDARNGLEGALVSLDAATGDMLALVGGA
NFNRNVFDHALQAYRQPGSSFKPFVYSAALEKGYFPGVLVDDTQRTLTRAETGAQPWRPR
NFGNRYEGFIPVRRGLVRSKNLVAVSLMQATDARYVQQHAVRFGFDAQRNPASLPLALGA
GAVTPLELASAYSVFANGGTRMEPRLILSVKQRHGGAMYEATAPSGERVVSARNAFVMDS
MLRDVVRAGTARGALALRRDDAAGKTGTSNGSKDVWFAGYSSGIVAVAWLGYDTPRPMGR
ATGATLALPVWLDYMKMAVDGRTPVDATPPQDVALVDGDFVYAEYAHGACTADVPAYIRS
RFACGGAPATDKPDAPGDSGKPDEPMPAAVDAAERERVLDLFRTDD
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccacaccgccaacccgtcaccgccacccgccccgccgccgcgccgcggacgc
gtgtggcgcacgctcgcgggcgtgctgctgggcctgacgcttgcgtgcgcgggcatcggc
gtttggacgatcaatcgcatctggacgcaactgccgtccgtcgagcatctggccgtctat
cgtcccgcgctgccgctgcggattttctcgcgcgacggcgacctgctggccgaatacggc
gtcgagcggcgcgagttcgtgccgctcgaacgcatcccgccgctgatgcggcacgcgctg
ctcgcggccgaggacgcgaagttctacgcgcacggcgcggtcgatgtcggcggcctcgcg
cgcgcgacgttcgcgaacgtcgtgacggggcagcccgggcagggcggcagcacgatcacg
atgcaggtcgcgcgcaacttctacctgacgcgcgacaaggtgctgagccgcaagctcgcc
gagatcctgatggccgccaagctcgagcgcgagtacagcaaggacaagctgctcgagctg
tacatgaacgagatctacctgggcgagcgcgcgtacggtttcgcggccgccgcgaacgtg
tatttcggcaagccgctcgacgcgctgagcgcgggcgaagcggccgtgctcgcggggctg
ccgaaggcgccctccgcgttcaacccggtcgtcaacccggcgcgcgcgaccgcgcggcgc
gactacgtgctcggccgcatgcatgcgctcggccagctcgacgacgcgacgtatcgcgcg
gccgtcgatgcgccgatcgtgctggcgaccacgccgccgccggggatcgtcgcggcgccg
tacgtcgccgagcgcgcacgccggatgatggtcgagcggtttcacgacgacgcttacacg
ctcggcctcgacgtgacgacgacgatctcgatgcgcgaccagcgcgcggccgaagcagcg
ctcgagcgcacgctgaaccggcagccgcgcgcgaagcgcgatgcgcgcaatgggctcgag
ggcgcgctcgtgtcgctcgatgcggcaaccggcgacatgctggcactggtcggcggcgcg
aatttcaatcgcaacgtgttcgaccatgcgctgcaggcgtatcgccagccgggctcgagc
ttcaagccgttcgtctattcggcggcgctggagaagggctacttcccgggcgtgctggtc
gacgacacgcagcgcacgctcacgcgcgcggaaaccggcgcgcagccgtggcggccgcgc
aatttcggcaaccgctacgagggcttcatcccggtgcggcgggggctcgtgcgctcgaag
aacctggtcgcggtcagcctgatgcaggccaccgacgcgcgttacgtgcagcagcacgcg
gtgcgtttcggtttcgacgcgcagcgcaatccggcgtcgctgccgctcgcgctcggcgcg
ggcgccgtgacgccgctcgaactcgcgagcgcctacagcgtgttcgcgaacggcggcacg
cggatggagccgcgcctgatcctgtcggtgaaacagcgtcacggcggcgcgatgtacgag
gcgaccgcgccgtcgggcgagcgcgtcgtctcggcgcgcaacgcattcgtgatggacagc
atgctgcgcgacgtcgtgcgcgccggcaccgcgcgcggcgcgctcgcgctgcgccgcgac
gacgcggccggcaagacgggcacgtcgaacgggtcgaaggacgtatggttcgccggctac
tcgtcgggcatcgtcgcggtcgcgtggctcggctacgacacgccgcgcccgatggggcgc
gcgaccggcgcgacgctcgcgctgccggtctggctcgactacatgaagatggccgtcgac
gggcgcacgccggtcgacgcgacgccgccgcaggacgtcgcgctcgtcgatggcgacttc
gtctacgccgaatacgcgcacggcgcctgcacggccgacgtgccggcgtatattcgcagc
cgcttcgcgtgcggcggcgcgccggcaaccgacaagcccgacgcgccgggcgacagcggc
aagcccgacgagccgatgcccgcggctgtcgatgcggccgagcgcgaacgtgtgctcgac
ctgttccggaccgacgactga

DBGET integrated database retrieval system