KEGG   Brucella suis bv. 1: BSS2_I1672Help
Entry
BSS2_I1672        CDS       T03181                                 

Gene name
tkt
Definition
(GenBank) tkt
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
bsf  Brucella suis bv. 1
Pathway
bsf00030  Pentose phosphate pathway
bsf01100  Metabolic pathways
bsf01110  Biosynthesis of secondary metabolites
bsf01120  Microbial metabolism in diverse environments
bsf01130  Biosynthesis of antibiotics
bsf01200  Carbon metabolism
bsf01230  Biosynthesis of amino acids
Module
bsf_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bsf_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
bsf_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:bsf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSS2_I1672 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    BSS2_I1672 (tkt)
Enzymes [BR:bsf01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     BSS2_I1672 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C E1_dh
Motif
Other DBs
NCBI-ProteinID: AHN47321
LinkDB All DBs
Position
I:1665715..1667706
Genome map
AA seq 663 aa AA seqDB search
MTNTDKQNQMANAIRFLSMDAVEKANSGHPGLPMGAADIATTLYTRFLSHDPKNPHWPDR
DRFVLSAGHGSMLLYSLLYLSGYEDITIDEIKKFRQLGSRTAGHPEYGHAAGIETTTGPL
GQGIANAVGMAISERILNAQFGDSLVNHYTYALVGDGCLMEGISQEAIALAGHLKLNKLI
VLWDDNNISIDGPITLSDNTDQPARFAASGWNTMAVDGHDQDAIAKAIELARVSDRPTLI
ACKTTIGFGAPNKAGTNKVHGSPLGAEEIAATRKALGWSSEPFVVPAEVLDAWRVAGLNA
AKKRLEWEKRLSAVEAETRAEFERRMRGELPSGFDAAIVEYKKKLSADKPKVATRKSSEM
ALEVINGVVPETVGGSADLTGSNNTKTSQTKAVTPENYDGRYIHYGIRELGMAAAMNGIT
LHGGLIPYSGTFLCFSDYARPAMRLSSLMGIRVVYVMTHDSIGLGEDGPTHQPVEHLAAL
RAIPNHNVFRPADAVETAECWQLALHSRKTPSTLALTRQNLPTVRTEHREENLCAFGAYE
LAAASSDAKVTIFATGSEVEIALKARDLLEGKGIATRVVSVPCFELFEQQSDAYKEATIG
DAPIKLAIEAAISLGWERFIGENGIFIGMKGFGASGEINDLYKHFGITAEHAVEAAEKKL
NAA
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaccaataccgacaaacaaaaccagatggctaatgcaatccgcttcctctccatggat
gcggtggagaaggccaattcgggccaccccggcctgccgatgggcgcagccgatatagcg
acgacgctttatacccgtttcctctcgcacgacccgaaaaacccgcactggccggaccgc
gaccgtttcgtgctttccgccggccacggctcgatgctgctctattcgctgctctatctt
tcgggctacgaagacatcaccatcgatgaaatcaagaaattccgccagcttggcagccgc
accgcgggccaccctgaatatggccatgccgctggcatcgaaacgacgaccggcccgctc
ggacagggtattgccaatgccgtcggcatggcgatttccgaacgcatcctgaatgcccag
ttcggtgacagcctcgtcaatcattatacctatgcgctcgtcggcgacggctgcctcatg
gaaggcatcagccaggaagccatcgcgcttgcgggacacctgaagctcaacaagctgatc
gtgctctgggatgacaacaacatctcgatcgacggcccgatcacgctttccgacaatacc
gatcagccagcccgtttcgccgcttccggctggaacaccatggctgtcgacggtcacgac
caggatgcgattgccaaggccatcgaactggcccgggtctccgaccgcccgacgctgatc
gcctgcaagacgaccatcggtttcggtgctccgaacaaggctggcaccaacaaggtgcac
ggctcaccgcttggcgcggaagaaatcgccgccacgcgcaaggcgctgggctggtcttcc
gaacctttcgtcgttccggctgaagttctggacgcctggcgcgtcgcgggcctcaacgcc
gccaagaagcgcctggaatgggaaaagcgcctttctgccgtagaagcggaaacccgcgcc
gaattcgagcgccgcatgcgtggcgagctgccttccggtttcgatgctgcaatcgtcgaa
tacaagaagaagctttccgccgacaagccgaaggttgccacccgcaagtcgtccgaaatg
gcgctggaagtcatcaacggtgtcgtgccggaaaccgtaggcggctctgccgaccttacc
ggctccaacaacaccaagaccagccagaccaaggctgtcacgccggaaaactatgatggc
cgttatatccattacggcatccgcgagcttggcatggctgcagcgatgaacggcatcacg
ctgcatggcggcctgatcccctattccggcaccttcctgtgcttctccgattatgcgcgt
ccggccatgcgtctttcctcgctgatgggcattcgcgtcgtctatgtgatgacgcatgat
tccatcggtcttggcgaagacggcccgacccatcagccggtcgaacatctcgccgcactg
cgcgccattccgaaccacaatgtcttccgtccggcagacgctgtggaaacggcggaatgc
tggcagcttgcgctgcattcaaggaagacgccatccacgctggctttgacccgccagaac
ctgccgacggtccgcaccgagcatcgcgaagaaaacctttgcgctttcggcgcctacgaa
cttgccgccgccagcagcgacgccaaggtgacgatcttcgcaacgggctcggaagtggaa
attgcgctgaaggcccgcgatcttctggaaggcaagggcattgccacccgcgtcgtttcg
gtgccgtgctttgagcttttcgagcagcagagcgacgcctacaaggaagcgaccattggc
gatgcgccaatcaagcttgccattgaagcggccatctcgctcggctgggaacgcttcatc
ggcgaaaacggcatcttcatcggcatgaagggcttcggcgcttcgggtgagatcaatgat
ctctacaagcatttcggcatcacggcggaacatgccgtcgaagctgcggaaaagaagctc
aacgctgcatga

DBGET integrated database retrieval system