KEGG   Brucella suis ZW046: IY72_04220Help
Entry
IY72_04220        CDS       T03427                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
bsg  Brucella suis ZW046
Pathway
bsg00970  Aminoacyl-tRNA biosynthesis
bsg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    IY72_04220 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bsg03029]
    IY72_04220 (gatB)
Enzymes [BR:bsg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     IY72_04220 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     IY72_04220 (gatB)
Mitochondrial biogenesis [BR:bsg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    IY72_04220 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AIN87196
UniProt: A0A2D2BNV4
LinkDB All DBs
Position
1:846067..847569
Genome map
AA seq 500 aa AA seqDB search
MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD
AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG
EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS
KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV
NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD
LLPLEFDQAFVDALAAKLPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR
DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN
EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKATG
GKANPQAVNELVKSKLGIEE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtccattatcgatacgcgtacacctgaacccaaacgcttcatctctggtgcgaccggc
gattgggaagtcgtcatcggaatggaagtccatgcgcaggtcacgtcagaatcgaagctg
ttttccggcgcttccaccgcattcggtgccgagccgaactccaatgtctctctcgtggat
gcggccatgccgggcatgttgccggtcatcaatctggaatgcgtgaggcaggctgtgcgc
accggcatcggcttgaatgcgcagatcaatctgaagtcggtcttcgaccgcaaaaattat
ttctatcccgatttgccgcagggctaccagatttcgcagttcaagcagccgatcgtcggt
gagggcaagatcatgatttcggtcggcccggacaacaagggccagttcgaggacgtggag
atcggcattgagcgcctgcatcttgagcaggatgcgggtaaatccatgcacgaccagcac
ccgaccatgtcctatgtggacctgaaccgttcgggcgtggcgctgatggagatcgtatcc
aagccggatctgcgctcgtcggatgaagcgcgcgcttacctcaccaagctgcgcacgatt
gtccgctatcttggcacctgcgatggcaatatggatgaaggttccatgcgtgctgacgtc
aatgtttcggtgcgccgtccaggcggcgaattcggcacgcgttgcgagatcaagaacgtc
aactcgatccgctttgtcggccaggccatcgaatatgaagcgcgccgccagattgccatt
ctggaagatggcggcgtgattgatcaggaaacgcgcctgttcgatccggtgaaaggcgaa
acccgttccatgcgctccaaggaagaggcgcatgactatcgttatttccccgatccggac
ttgttgccgcttgaattcgatcaggccttcgtggatgcgctggcggccaaattgccggaa
ctgccggatgtgaaaaagcagcgccttgtcgaaacgcttggcatttccgtttatgacgcc
tcgatccttgtgacggagaaggccatagccgattattatgaggcggttgccgaggggcgc
gacggcaaggctgccgcaaactgggtcatcaacgatcttctgggcgcgctgaacaaggcg
ggcaaggatatcgaggaatcgccgattagccccgcccagcttggcgccatcatcgatctc
atcaaggaaggtacgatttccggtaagatcgcaaaggatcttttcgagatcgtctggaat
gagggtggcgatccgaagaagctcgttgaagagcgcggcatgaagcaggttacagatacc
ggcgcgattgaaaaggctgtcgatgacgtcattgccgccaacccggacaaggttgagcag
gccaaggcgaagccgacgctggctggctggtttgtcggtcaggtcatgaaggcgacgggc
ggcaaggccaacccgcaggccgtcaatgaactggtgaaatccaagctggggattgaggaa
taa

DBGET integrated database retrieval system