KEGG   Brucella suis ZW046: IY72_04670Help
Entry
IY72_04670        CDS       T03427                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
bsg  Brucella suis ZW046
Pathway
bsg00550  Peptidoglycan biosynthesis
bsg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IY72_04670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsg01002]
    IY72_04670
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsg01011]
    IY72_04670
Enzymes [BR:bsg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     IY72_04670
Peptidases [BR:bsg01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   IY72_04670
Peptidoglycan biosynthesis and degradation proteins [BR:bsg01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   IY72_04670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AIN87272
UniProt: A0A2D2BP45
LinkDB All DBs
Position
1:928013..929203
Genome map
AA seq 396 aa AA seqDB search
MGLFSRITAIRAGLLLGTVFAAVPPAWAAPANSSIVTKAPQALLIDDRSGTVLLSKGADK
PVPPASLAKLMTAEVVFEALEKGRTTLETAYPVSEYAWRTGGAPSGTSTMFARIKSTPTV
ADLLQGMIVQSANDGAIVLAEGLAGSEQTFAGAMNQRAKELGLSSSKFVNSTGLPAAGQV
VTLEDLLNLARHIHAAHPEYYRYYEQPAYTWNNITQRNRNPLLRLEVGADGMGTGFTEAS
GYALVGSAEQNGRRLFLAMSGLASVKEREEEARKLIQWGMTGFDDMRIFAANDKVGDAQV
FGGQSSTLPLVVKKDVELLLPKEAREKLKARIIYEGPLQAPIAAGTEVGRLQFELNGSVL
QQVPVFAAQSVAQGSLPQRALGSVVEFSTGWLRKYL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggggcttttttccagaatcacagcaatcagggctggccttctgttgggaacggttttt
gccgcggtgccgcctgcatgggctgcacctgcgaattcgtccattgtcaccaaagcaccg
caagccttgctgatcgacgatcgcagcggaacggttcttctttcaaagggcgccgataag
ccggttccaccggcttcgctggcaaagctgatgacggcggaagttgttttcgaggccctg
gaaaagggccgcacaacgcttgaaacagcctatcctgtcagcgaatatgcgtggcgcaca
ggcggcgcaccgtccggcacatcgaccatgtttgcgcgcatcaaatcgacgccgacggtt
gcagatcttctgcaaggcatgatcgtccaatcggcaaatgacggcgcaatcgttctggcc
gagggccttgccggtagcgaacagacctttgccggggcaatgaaccagcgcgcgaaggag
cttggcctttcctcgtcgaaattcgtgaattccaccggcctgccggcggcggggcaggtg
gtgacactggaggatttgctaaatctcgctcgccatatccatgcggcgcatcccgaatat
tatcgatattatgagcagcccgcctacacctggaataatatcacccagcgcaaccgcaat
ccgctgctgcggctcgaagttggcgcggacggcatgggaaccggatttaccgaggcttcc
ggctatgccctggttggctcggctgaacagaacggccggcggctttttctggcgatgagc
ggccttgccagtgtgaaggaacgggaggaagaagcccgcaaactcattcaatggggcatg
accggctttgatgatatgcgcatttttgcggcaaacgataaggtcggcgatgcgcaggtc
tttggcgggcaatcctcaaccttgccgctggtggtgaagaaggatgtggaactgcttttg
ccgaaggaggcgcgcgaaaagctgaaggcacgcatcatctatgagggtccgttgcaagcc
cccatcgccgcgggaacggaagttggcaggctgcaatttgaattaaacggcagcgttttg
cagcaagtgcccgtttttgcggcgcaatccgtcgcgcaaggcagcctgccgcagcgggca
ttgggatccgtggtcgagttttcgaccggctggctcaggaaatacctttga

DBGET integrated database retrieval system