KEGG   Brucella suis ZW046: IY72_07525Help
Entry
IY72_07525        CDS       T03427                                 

Definition
(GenBank) ABC transporter
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
bsg  Brucella suis ZW046
Pathway
bsg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsg00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    IY72_07525
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsg02000]
    IY72_07525
Transporters [BR:bsg02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    IY72_07525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N TniB
Motif
Other DBs
NCBI-ProteinID: AIN87792
UniProt: A0A4Z0EXI6
LinkDB All DBs
Position
1:complement(1511612..1512649)
Genome map
AA seq 345 aa AA seqDB search
MSNLNKSASLLRIENLRVGFGRDGMVLDAVRGLNLELERGEVLGIVGESGSGKSIGMLAA
IGLAPPNAKVTGSVTFQGQELLGRSRREMRELRGSRIAMIFQDPLSSLNPVMKIGDQIIE
ALQLHQKGLSRKQALARAVELLELVSIPQPDQRVKQYPHEFSGGMRQRVMIAMAVANDPD
LLIADEPTTALDVTVQAQIMAVLRDLQDKLGLGLILITHDLGVLAGHADRVAVVYAGEVV
EKAGIYELFENPRHPYTRGLIASIPTLGDSGGKLFSIEGAPPVPGAFPQGCAFHPRCVHA
QAICREKAPAYRRFGEHISACHFAESLPPFKRDTNEELMEGCTHA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatcttaacaaaagtgccagccttctccgcatagaaaacctgcgggtcggtttc
ggccgtgatggaatggtcctggatgcggtgcgggggctcaatctcgagctggaacggggc
gaggtgctggggattgtgggcgagtccggctcgggaaaatccatcggcatgctggctgca
atcggcctggcacccccaaatgcgaaagtaaccggttcggtcacattccaggggcaggaa
ctgttgggccgatcccgccgggagatgcgcgagttgcgggggtccaggattgcgatgatc
tttcaggacccgctttcatcgctgaacccggtgatgaaaatcggcgatcagatcatcgaa
gcgttgcagctccaccagaagggcctgagccgcaaacaggcgctggcgcgcgcggtggaa
ttgctggaactggtttcgatcccgcaacccgaccagcgggtcaaacaatatccgcatgag
ttttccggcggcatgcgccagcgtgtcatgattgcgatggccgtcgccaacgatcccgat
cttctgatcgcagacgagcctaccaccgctctcgatgtgacggttcaggcgcagatcatg
gccgtcctgcgcgatcttcaggacaagctcggcctgggactgatcctcatcacgcatgat
cttggcgtactcgccggtcatgccgacagggtggccgtcgtctatgccggagaggtggtg
gaaaaggccgggatatacgagctttttgaaaacccgcgccatccttatacgcgcgggctg
atcgcctccattccgacacttggcgatagcggcggaaaactgttttccattgaaggcgcg
cctccggtgcccggcgcctttccgcaaggatgcgctttccatccgcgctgcgtgcatgca
caggccatatgccgggagaaagccccagcctatcggcggttcggggagcatatatcggcg
tgccatttcgccgaaagcctgccgcccttcaaacgtgacaccaatgaagaacttatggag
gggtgcactcatgcgtga

DBGET integrated database retrieval system