KEGG   Brucella suis ZW046: IY72_13965Help
Entry
IY72_13965        CDS       T03427                                 

Definition
(GenBank) enterobactin ABC transporter permease
  KO
K02015  iron complex transport system permease protein
Organism
bsg  Brucella suis ZW046
Brite
KEGG Orthology (KO) [BR:bsg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsg02000]
    IY72_13965
Transporters [BR:bsg02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    IY72_13965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD PNTB_4TM
Motif
Other DBs
NCBI-ProteinID: AIN88954
UniProt: A0A4Z0F2K6
LinkDB All DBs
Position
2:621440..622393
Genome map
AA seq 317 aa AA seqDB search
MHKRPAIVIALLGALTLLACVAFMTLGAKGSWSFVLSFRGTKLAAMVLVAYSVAVSTVLF
QTVTNNRILTPSIMGFDALYILIQTLVVFFFGAVQIDWLGPNARFLAETAIMVVFAGTLY
YWLFSGAARSLHLIMLVGIVCGVFFRSISNLMQRMLYPNLFAILQDRFFASFNAINADIL
VISAIVVAAVSLYGLRYLYVLDVLSLGRDPAINLGVDHARVVRKILFIVTVLVSVSTALV
GPITFFGLLVANLAYMISGSARHRIVLPVAVLLAVLCIVGGQTLLERVLAFNTALSVIIE
FLGGLFFIILLVRGNAR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttgcataaacgccctgccatcgtcatcgcacttctgggcgcgctcacgcttcttgcctgc
gtggccttcatgacgcttggcgcaaagggaagctggtccttcgtgctttcatttcgcggc
accaagctggcagccatggttctggtcgcctattcggtggccgtctcgacggtcctgttc
cagaccgtcaccaataatcgcatcctcacgccatcgatcatgggcttcgatgcgctctat
atcctgatccagacgctcgttgtcttcttcttcggcgcagtgcagatcgactggctcggg
cccaatgcgcgctttctggctgaaaccgccatcatggtcgtgttcgcaggcacgctttat
tactggctgttttcgggcgctgcccgcagcctgcacctcatcatgctggtcggcatcgtc
tgcggcgtctttttccgcagcatttccaacctgatgcagcgaatgctctacccaaacctg
tttgccatcctgcaagacaggttcttcgccagtttcaatgccatcaatgccgatatcctt
gtgatctcggccatcgtcgttgccgccgtatcgctctatggcctgcgttacctatatgtc
ctggacgtcctgtcgcttgggcgcgatcccgcgatcaatcttggtgtcgatcatgccagg
gtggtgcgcaagatcctgttcatagtgacggtgctcgtttccgtctccaccgccctcgtc
ggcccgatcaccttctttggccttctggtcgccaatcttgcctatatgatttcaggctcc
gcccggcaccgcatcgtgctgccagtggcggtgctattggcggttctctgcattgtcggc
ggccagaccttgcttgagcgcgtccttgcgttcaacactgcgctcagcgtcatcatcgag
tttctgggcggcctcttctttatcatccttctcgtcagggggaacgcgcgttga

DBGET integrated database retrieval system