KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_03370Help
Entry
BSU6051_03370     CDS       T02503                                 

Gene name
yckA
Definition
(GenBank) putative ABC transporter permease YckA
  KO
K10009  L-cystine transport system permease protein
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Pathway
bsh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU6051_03370 (yckA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsh02000]
    BSU6051_03370 (yckA)
Transporters [BR:bsh02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    BSU6051_03370 (yckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AGG59680
LinkDB All DBs
Position
complement(367305..367985)
Genome map
AA seq 226 aa AA seqDB search
MINSIQWEYIFNTKLAIESFPYVIKGIGYTLLISFVSMFAGTVIGLFISLARMSKLALLR
WPAKLYISFMRGVPILVILFILYFGFPYIGIEFSAVTAALIGFSLNSAAYIAEINRSAIS
SVEKGQWEAASSLGLSYWQTMRGIILPQSIRIALPPLANVLLDLIKASSLAAMITVPELL
QHAKIIGGREFDYMTMYILTALIYWAICSIAAVFQNILEKKYAHYV
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatagcattcagtgggaatatattttcaacacgaagctggccattgaatcgttc
ccttatgtcataaaaggcattggttatacactgctcatctcttttgtaagcatgtttgcg
ggaactgtgatcggcctgttcatatcactcgccagaatgtctaaacttgctttgttaaga
tggccggcgaagctctatatctcatttatgcgaggcgttccgattttggtgattttgttt
atcctttatttcgggtttccttatatcggcattgaattttccgctgtcacggctgcttta
atcggctttagcctaaacagcgccgcctacattgcggaaattaaccgttcagccatttca
tccgtcgaaaaaggacagtgggaagccgcatcctcgctgggtctttcctattggcagacg
atgaggggcatcattttgccgcaatcgatacgtattgcgctgcctccgcttgccaatgta
ttgctcgacttgatcaaggcgtcctctctcgctgcgatgattacagtgccggaattgctc
cagcatgcgaaaatcatcgggggcagagagtttgattatatgaccatgtatattctgacc
gctctcatttattgggccatctgctccattgccgcggtctttcagaatatccttgagaaa
aaatacgctcattatgtttaa

DBGET integrated database retrieval system