KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_21480Help
Entry
BSU6051_21480     CDS       T02503                                 

Gene name
sunA
Definition
(GenBank) SPBc2 prophage-derived bacteriocin sublancin-168
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nup214_FG
Motif
Other DBs
NCBI-ProteinID: AGG61541
LinkDB All DBs
Structure
PDB: 

Position
complement(2269520..2269690)
Genome map
AA seq 56 aa AA seqDB search
MEKLFKEVKLEELENQKGSGLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagctatttaaagaagttaaactagaggaactcgaaaaccaaaaaggtagtgga
ttaggaaaagctcagtgtgctgcgttgtggctacaatgtgctagtggcggtacaattggt
tgtggtggcggagctgttgcttgtcaaaactatcgtcaattctgcagataa

DBGET integrated database retrieval system