KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_27040
Entry
BSU6051_27040     CDS       T02503                                 

Gene name
levG
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IID component LevG
  KO
K02771  fructose PTS system EIID component
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Pathway
bsh00051  Fructose and mannose metabolism
bsh02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSU6051_27040 (levG)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU6051_27040 (levG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsh02000]
    BSU6051_27040 (levG)
Transporters [BR:bsh02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BSU6051_27040 (levG)
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: AGG62106
LinkDB
Position
complement(2760216..2761043)
AA seq 275 aa
MEKEKRLTKKEIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKKLYGPGAKRNEALQR
HLEWFNTHPWLTAPIFGVTAAMEEEMANNKGIDGKAISGMKIGLMGPIAGVGDPIFWGTI
RPVLAALGASLALGGNIAGPLLFFFLLNAIRLSTKYYGLKYGYVKGMEILQDLAGNRIQK
LTEGASILGLFVMGALVSKWTTINIPIVVSRIKDESGKVDVQTVQNVLDSIMPGALPLGL
TLLVAWMLRKGVNPLLIICGIFVIGILGYWAGFLA
NT seq 828 nt   +upstreamnt  +downstreamnt
atggagaaagaaaaacgattaacgaagaaagaaattttcagcatgtttattcgttcaaat
tttttactcggttcctttaacttcgaacgtgtgcaggcaatgggatattgttatgtcatg
ataccggcgatcaaaaaattgtacggtcccggagcgaaaagaaacgaagccttacagcgg
catttggaatggtttaatacacatccgtggctgacagcgcctatatttggcgtgacggca
gccatggaagaagaaatggcgaacaataaaggaattgacggaaaagcgataagcggaatg
aaaatcggtttgatgggaccaatagcgggcgtaggcgatccgattttttggggaacgatt
cgtcctgtcttagctgcgctaggagcctcccttgctttaggaggaaacattgccggtcct
ttgctattctttttcttgctgaatgccataagattaagcacaaaatattacggattaaag
tatggctatgtgaaaggaatggagattcttcaggatttagcggggaatcgcattcaaaag
cttacagagggcgcttcgattctcgggttatttgttatgggggctctcgtgtccaaatgg
accaccatcaacattccaatcgttgtatccaggattaaggatgaaagcggaaaagtagat
gttcaaacggtacaaaacgtgctagatagcattatgccgggggcgctgcctctcggatta
acgttattggtggcatggatgcttcgcaaaggggtgaatccacttctcattatttgcggc
atctttgtcatcgggattctcgggtattgggctggattcttagcataa

DBGET integrated database retrieval system