KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_27580Help
Entry
BSU6051_27580     CDS       T02503                                 

Gene name
yrvJ
Definition
(GenBank) putative N-acetylmuramoyl-L-alanine amidase, family 3
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Pathway
bsh01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:bsh00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BSU6051_27580 (yrvJ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsh01011]
    BSU6051_27580 (yrvJ)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsh03036]
    BSU6051_27580 (yrvJ)
Enzymes [BR:bsh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     BSU6051_27580 (yrvJ)
Peptidoglycan biosynthesis and degradation proteins [BR:bsh01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   BSU6051_27580 (yrvJ)
Chromosome and associated proteins [BR:bsh03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BSU6051_27580 (yrvJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SH3_3 Amidase_3 SH3_4 SH3_16
Motif
Other DBs
NCBI-ProteinID: AGG62162
LinkDB All DBs
Position
2818476..2820032
Genome map
AA seq 518 aa AA seqDB search
MNKKYFVLIVCIIFTSALFPTFSSVTAAQGEAVIATDEMNVRSGPGLSYGITAEVKKGER
YPILKEDGDWVQIQLGSGEKGWVVSWLITKEDQASTSSSGSSDTVTSTDPDLRMRSGPGT
SYEVIGKFPQGSQASVIDKDSGWIKISYHSATGWVSSEYVTSGGSSSASDESDQTEDSGA
STTGTVGVSSLNVRASASHDAAIITKLDRGTKLTVLNEKNGWAHIEVNGLKGWVASHYLL
TSSVPADDSANAGSSSSAKKAYIMYGGTNLRSDASTSASIVERAAKGDSYTITGSKGSWY
EIKLDNGQTAYVANWVVQTSKSAEEAGEPPVSDSPSGNGSLNNKTIIVDPGHGGKDSGTI
GYSGKFEKNLTIKTAKLLASKLRSAGADVYVTRQDDTFVSLQSRVSTSHYRNADAFISIH
YDSYADTSTRGSTAYYYSPAKDQELASDVHSEVVKRSSIPDRGVLFGDYYVLRENRQPAM
LYELGYVSHPQEEAIVHSNSYQEKVTDGIESGLEKYFQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaaatactttgtccttattgtatgtattattttcacctcagcgctattcccg
accttttcatccgttacagctgctcaaggagaagcggtcatcgcaacagatgaaatgaac
gtcagaagcggcccagggcttagctacggcattacagcggaagtaaaaaagggagaacgc
tatccaattttaaaggaagatggagactgggtgcagatacagcttggttctggagaaaag
ggctgggtagtctcctggcttattacaaaggaagaccaggccagcacaagctcctcagga
agcagtgacactgtgacatcaacagaccccgatctgcggatgagaagcggcccgggcact
tcctacgaagtcatcggcaaattcccgcaaggcagccaagcatctgtcattgataaagat
tcgggctggatcaagatatcctatcacagtgccaccggatgggtatcatctgaatatgtc
acatcaggaggcagcagttcagcgtctgatgagagtgaccaaaccgaggattccggtgcg
tcaacgacgggcacagtcggtgtttcttcgctaaatgtaagagcctccgcctcacatgac
gcggcaattataacaaaacttgatcgcggaacgaaactgacggttctcaacgagaaaaat
ggctgggctcacattgaggtgaacgggctaaaaggctgggttgcaagccattaccttttg
actagttctgttccagctgatgattcagcaaatgccggcagttcatcctccgctaaaaaa
gcctatatcatgtacggaggaacgaatctaagaagtgatgcgtcaacatcagcttcgatc
gttgagcgcgctgccaaaggagattcatacaccattaccggttcaaagggaagctggtat
gaaataaagcttgataacgggcagactgcttatgtagccaattgggtggtccaaacgtct
aaaagcgcagaagaagcaggtgaaccgccagtctctgattccccgtctggaaacggctct
ctaaacaataaaacgattattgttgacccgggacatggaggaaaagacagcggaacgatc
gggtattcggggaaattcgagaaaaacctgacgatcaaaacggcaaaactgctcgccagc
aaacttagatcggctggagcggatgtatatgtgacacgccaggatgatacctttgtcagc
ctgcagtcacgggtctctacctctcactaccgtaacgctgacgcctttatcagcattcat
tatgacagctatgcggatacctctacaagaggcagtacagcatattactacagtcctgcc
aaagatcaggaactcgcatcagatgtccactcagaagtggtgaagcgttcttccattcca
gaccgcggcgtattattcggagattattatgtgctccgggaaaacagacagcccgctatg
ctgtacgagctgggatatgtaagccatccgcaggaagaagccattgtacatagcaattca
taccaagaaaaagtaacagatgggatcgaaagcggattagagaaatacttccaataa

DBGET integrated database retrieval system