KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_29560Help
Entry
BSU6051_29560     CDS       T02503                                 

Gene name
ytcI
Definition
(GenBank) putative acyl-coenzyme A synthetase YtcI
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Pathway
bsh00010  Glycolysis / Gluconeogenesis
bsh00620  Pyruvate metabolism
bsh00630  Glyoxylate and dicarboxylate metabolism
bsh00640  Propanoate metabolism
bsh00680  Methane metabolism
bsh01100  Metabolic pathways
bsh01110  Biosynthesis of secondary metabolites
bsh01120  Microbial metabolism in diverse environments
bsh01130  Biosynthesis of antibiotics
bsh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU6051_29560 (ytcI)
   00620 Pyruvate metabolism
    BSU6051_29560 (ytcI)
   00630 Glyoxylate and dicarboxylate metabolism
    BSU6051_29560 (ytcI)
   00640 Propanoate metabolism
    BSU6051_29560 (ytcI)
  09102 Energy metabolism
   00680 Methane metabolism
    BSU6051_29560 (ytcI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsh01004]
    BSU6051_29560 (ytcI)
Enzymes [BR:bsh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BSU6051_29560 (ytcI)
Lipid biosynthesis proteins [BR:bsh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BSU6051_29560 (ytcI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AGG62362
LinkDB All DBs
Position
complement(3023659..3025248)
Genome map
AA seq 529 aa AA seqDB search
MLKREDLIAPVQYNLVNEMEKFSAAGQKTALLWEDESGKQESWSYEKLMEETNKIGAALA
DLGFKKGDKLIVMVPRVLEAYAVYLAILKSGMVVIPCSEMLRAKDLEYRIEHAEVKGAIV
YSEFIGAFRDVSTADKLITLSIGENDAGWKNLLSIEADGSQFKTADTTRDDMAFLSYTSG
TTGQPKGVVHTHGWAFAHLKTSAGAWLDISEKDIVWATAAPGWQKWVWSPFLAVLGSGAT
GFVYHGRFKAEKYLELLNRYKINVFCCTPTEYRLMAKVEGLKRFDLSALHSAVSAGEPLN
REVIDVFQKHFGIKVRDGYGQTESTLLVGVLKDTPIKPGSMGKPTPGNQVEIINEDGEIC
KPGEVGDIAVHLSTPALFKEYFKDPERMKTQIRGDYFLTGDRARKDEEGYFWFESRNDDI
IISSGYTIGPFEVEDALVKHPEVKECAVVASPDEIRGSIVKAYVVLQNHEKRSDELVKML
QNHVKTITAPYKYPREIEFVESLPKTASAKIRRVELRKREEQLKANKKA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaacgtgaagatttaattgcccctgtgcaatataatttagtgaatgaaatggaa
aagttcagtgctgctggacaaaaaaccgctcttctttgggaggacgagtcgggcaagcaa
gaatcttggtcgtatgaaaagctgatggaagaaacaaataaaatcggagcggccttagct
gatcttggatttaaaaagggagacaagctgattgtaatggttccgcgggtgcttgaagcc
tatgctgtttatttggctatcctgaaatcaggaatggttgtcattccgtgctccgaaatg
cttcgcgcgaaagatcttgaataccggattgaacatgcagaggtaaaaggcgctatcgtc
tactccgaatttattggcgctttccgggatgtcagtacggctgacaaactgattacactg
tctattggtgaaaatgatgccggctggaaaaacctcttatcaattgaagcggacggaagc
caatttaaaacagctgacacaacaagagatgatatggctttcttatcttatacatccggg
acaacaggtcagccgaaaggtgttgtacatacacatggatgggcatttgctcatttaaaa
acttctgccggcgcttggcttgacatttctgaaaaggatatcgtctgggcaactgctgcc
cctggctggcaaaagtgggtatggagtccgtttttagcggtgcttggcagcggagcaacc
ggttttgtgtaccacggcagattcaaagcagaaaaatatctagagcttttaaatcgctac
aaaatcaatgttttctgctgcactccgacagaataccgcttaatggcgaaggttgaaggc
ttgaaacgctttgatctttctgccctgcacagcgctgtttccgcaggtgagccgctcaac
cgtgaagtcattgatgttttccaaaagcactttggcattaaggtacgggacggatatggc
caaacagaaagcacgcttttggttggtgttttgaaagatacgcctattaaaccgggaagc
atgggaaaaccgacaccgggaaatcaggtggagatcataaatgaagacggtgaaatctgc
aaacctggtgaggttggcgatatcgctgttcacctcagtacgcctgcgctctttaaagag
tattttaaagatccggaaagaatgaaaacacaaattcgcggcgattatttcctaacggga
gacagagcaagaaaagatgaggaaggttacttctggtttgaaagccgaaatgacgatatt
attatcagctccggctatacgatcgggcctttcgaggtggaagacgcgcttgttaagcac
ccagaagtaaaagaatgtgctgttgtcgcaagccctgatgaaatcagaggctccatcgta
aaggcatatgttgtcctgcaaaatcatgaaaaacgcagtgatgagcttgtcaaaatgctg
caaaaccatgtgaagacgattaccgctccatacaaatatcctagagaaattgaatttgtg
gaaagcctgccgaaaacggcttctgcaaaaatcagacgagtggaattaagaaaacgtgaa
gaacagctcaaagccaataaaaaggcgtaa

DBGET integrated database retrieval system