KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_32800Help
Entry
BSU6051_32800     CDS       T02503                                 

Gene name
yusH
Definition
(GenBank) putative glycine cleavage system protein H YusH
  KO
K02437  glycine cleavage system H protein
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Pathway
bsh00260  Glycine, serine and threonine metabolism
bsh00630  Glyoxylate and dicarboxylate metabolism
bsh01100  Metabolic pathways
bsh01110  Biosynthesis of secondary metabolites
bsh01130  Biosynthesis of antibiotics
bsh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSU6051_32800 (yusH)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU6051_32800 (yusH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_H Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: AGG62688
LinkDB All DBs
Position
complement(3366103..3366486)
Genome map
AA seq 127 aa AA seqDB search
MSIPKDLRYSGEHEWVKVEGEKARIGITHFAQSELGDIVFVELPEVGAEIKADEPFGSVE
SVKTVSELYAPINGTVVEVNEDLDDSPEFVNESPYEKAWMIVVEPSDASEIEKLMTAEQY
EEMTQED
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
ttgagcataccaaaagatttgcgttactcaggagaacacgagtgggtaaaagttgaagga
gaaaaagccagaatcggaattacgcattttgcccagtccgaactaggcgacatcgtgttt
gtcgaacttcctgaagtgggcgctgaaatcaaagcggacgagccattcggcagtgttgaa
tccgttaaaacggtatctgagctttatgcaccgattaacggaacggttgtggaagtaaac
gaagatcttgatgacagtccggaattcgtcaacgaatctccgtacgaaaaagcatggatg
atcgtcgttgagccatctgacgcttctgaaattgaaaaactgatgacagcagagcaatac
gaagagatgacacaagaagactaa

DBGET integrated database retrieval system