KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_40690Help
Entry
BSU6051_40690     CDS       T02503                                 

Gene name
yybC
Definition
(GenBank) putative integral inner membrane protein YybC
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2798
Motif
Other DBs
NCBI-ProteinID: AGG63493
LinkDB All DBs
Position
4181986..4182465
Genome map
AA seq 159 aa AA seqDB search
MPANKKEGLIFGVMMCFGMVCVMSIYNAIINRAIYDFSLMTVFEMVIGFMIALLLDLLLV
GPLAKKIAFRMPFDKTKKIYVILAMSTCMVIGMVLCMSVFGLVTAVLANGLNGDSLFSAY
LMIVLKNFILAYPLQLLIMGPLVRGVFMKFVKPKLTAAI
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaaataaaaaagaaggccttatatttggcgtgatgatgtgctttggaatggtt
tgcgtcatgtcgatttacaatgccatcatcaaccgagccatctacgatttttcactgatg
accgtttttgaaatggtcatcggttttatgatcgccctcctgttagatttactgttagtg
ggccccctcgccaagaagattgcattccgcatgccgttcgacaagactaaaaaaatttat
gtcatccttgccatgtcaacttgtatggtgattggcatggtactttgtatgtctgtgttc
ggtttagtgacagcggttctagcaaatgggctgaacggggacagcctcttcagtgcttat
cttatgattgtgttgaaaaatttcatcctggcctatccgttgcaattactgattatgggc
ccattagtcagaggagttttcatgaaatttgtaaaaccaaagctcacagccgcaatttaa

DBGET integrated database retrieval system