KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_40710Help
Entry
BSU6051_40710     CDS       T02503                                 

Gene name
yybA
Definition
(GenBank) putative transcriptional regulator MarR family
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 HTH_24 TrmB HTH_11 HTH_Crp_2 HTH_36 GntR Fe_dep_repress DUF505 HTH_AsnC-type B-block_TFIIIC
Motif
Other DBs
NCBI-ProteinID: AGG63495
LinkDB All DBs
Position
complement(4183449..4183901)
Genome map
AA seq 150 aa AA seqDB search
MNDILREIGMIARALDSISNIEFKDLDLTRGQYLYLVRIYENPGIIQEKLAEMIKVDRTT
AARAIKKLEMQGFIQKLPDEQNKKIKKLFPTEKGKKVYPLLRREGEHSTEVALSGFTSEE
KETISALLHRVRKNIERDWEYVKKGNKRDY
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatattttgcgtgagatcggcatgatagcaagagcgttggattccataagcaac
atcgaatttaaagatttagacttaacaagagggcagtatctctatctcgtgcgtatatac
gaaaatccgggaattattcaagaaaaattggcggaaatgataaaagtggaccggacaacg
gccgcgcgggccattaagaagctggaaatgcagggatttattcaaaaactgccggatgag
caaaataaaaaaataaaaaaactgttcccgactgagaaagggaaaaaggtatatccattg
ttaagaagagaaggagaacattccacggaagtggccttgtccggttttacttcagaggaa
aaggaaaccatttctgcactccttcatagagtgaggaagaatatagaacgtgattgggaa
tatgtgaagaaggggaacaaaagggattattaa

DBGET integrated database retrieval system