KEGG   Bacillus siamensis: CWD84_01685
Entry
CWD84_01685       CDS       T06647                                 

Definition
(GenBank) pyridoxal phosphate-dependent aminotransferase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bsia  Bacillus siamensis
Pathway
bsia00998  Biosynthesis of various secondary metabolites - part 2
bsia01100  Metabolic pathways
bsia01110  Biosynthesis of secondary metabolites
Module
bsia_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bsia00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    CWD84_01685
Enzymes [BR:bsia01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     CWD84_01685
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C
Other DBs
NCBI-ProteinID: AUJ75622
UniProt: A0A2K9KBC1
LinkDB
Position
327084..328283
AA seq 399 aa
MEIIPSDVIKTLPKQEFSLVFQKVKEMEKTGAQIINLGQGNPDLPTPPHIVETLREAALN
PSYHGYGPFRGYPFLKEAIAEFYEREYGVSVNPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAELHEMPLHPENGYFPDFERIDPAVLKKAKLMFLNYPNNPT
GATADQAFYEKAAAFAKKHDIHLIHDFAYGAFEFDQNPASFLQAKEAKTIGAELYSFSKT
FNMAGWRMAFAVGNEKIIQAVNEFQDHVFVGMFGGLQQAAAAALSGNPEHTERLKRTYKE
RIDFFTALCEKELGWSIEKPKGTFYVWAEIPNEFESSHQFSDYLLEHAHVVVTPGEIFGS
GGKRYVRISMVAKQGDLREFVMRIQKLGLSFPSLQETSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaatcataccgtccgacgtcatcaagacacttccgaaacaggaattttcgctcgtt
tttcaaaaggtaaaagagatggagaaaacgggagcccagattattaacctcgggcagggg
aatcccgatctccccacaccgccgcatatcgttgaaacattgcgggaggctgcgctgaat
ccttcgtatcacggatacggcccgttcagaggctatccgtttctgaaagaagccatcgcg
gaattttatgagagagagtacggggtatcggtcaatccggagacagaagtcgcgctgttc
ggcggagggaaagctggtttgtacgttttgacgcaatgcctgttgaatcccggcgatatc
gccttagtcccgaaccccggctaccctgagtatttatcgggcattacaatggccagagcg
gagctgcatgagatgccgcttcatccggaaaacggctattttccggattttgagcggatt
gatcccgccgtcctgaaaaaagccaagctgatgtttttgaattacccgaataacccgacg
ggcgcgactgcggatcaggcgttttatgaaaaagcggcagcgtttgcaaaaaaacatgac
atccaccttattcacgattttgcatacggcgcgttcgaatttgatcagaatccggccagc
tttcttcaggcgaaagaagcgaaaacgatcggcgcggagctttattcattttcgaaaacc
ttcaatatggcaggttggagaatggcatttgccgtggggaatgagaaaatcattcaggcg
gtcaatgagtttcaggatcacgtcttcgtcggcatgttcggcggtcttcagcaggcggca
gcggcagcgctgtcaggaaatcctgagcataccgagcgtctgaagcgcacatataaagaa
cggattgactttttcacggcgttatgtgaaaaggaattaggctggagcattgaaaaaccg
aaggggactttttatgtctgggctgaaattccgaatgaattcgagtcttcacaccagttt
tcggactatctgctggagcatgcccatgttgtcgtgacgcccggcgagattttcggcagc
ggcggaaagcgttatgtcaggatatcaatggtggccaaacagggtgatttaagggaattc
gtgatgcggattcaaaagctcggtttgtcctttccttcattacaagaaacatcccgctga

DBGET integrated database retrieval system