KEGG   Bacillus simplex: UP17_01375Help
Entry
UP17_01375        CDS       T04304                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bsj  Bacillus simplex
Pathway
bsj00473  D-Alanine metabolism
bsj01100  Metabolic pathways
bsj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    UP17_01375
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    UP17_01375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsj01011]
    UP17_01375
Enzymes [BR:bsj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     UP17_01375
Peptidoglycan biosynthesis and degradation proteins [BR:bsj01011]
 Precursor biosynthesis
  Racemase
   UP17_01375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AMM95329
UniProt: A0A127DE06
LinkDB All DBs
Position
272172..273335
Genome map
AA seq 387 aa AA seqDB search
MGLETKNFHRDTWAEVNLDNIFENISSMKNRLRNGVSLFAVVKANAYGHGDYEVAKTALE
AGADFLSVAFLDEALALRKKGILAPILVLGASRPESAALAADNGISVTVFDVTWLEKAKD
LLKPGQVLQVHVKVDSGMGRIGIRDKGQLLKVESLLNGETCFNFQGIFTHFATADEIKTD
FYEKQLASFKGMLSALIRRPEYIHAANSAASLRFSDPESNAIRMGISMYGLSPSMEMKPI
LPFPLKQAISLRTKMVAVKQLTKGESVSYGATYTAEGDEWIGTLPIGYADGWIRKLQGQE
VLVDGSRVPIVGRICMDQCMVKLPRSYPVGTEVTLIGNDGDESITVDEVAAKLETINYEV
TCMIGARVPRVYIKDNQLIHVRNFILE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgggcttggaaacgaaaaactttcatcgggatacgtgggcagaagtaaatttggataat
atttttgaaaatatctcttcaatgaaaaatagactgagaaatggcgttagtcttttcgct
gtcgttaaagcgaatgcttatggccatggtgactatgaagtggctaaaaccgcgcttgaa
gcgggggctgattttttaagtgtcgctttcttagatgaggctcttgctttacggaaaaaa
ggaatattggctccgattcttgtacttggggcttcgaggcctgaaagtgcagcgcttgct
gccgataatgggatttccgtgacggttttcgatgtaacatggttggagaaggcaaaggat
ttattgaaaccgggacaagttctgcaagttcatgtaaaggttgatagcggcatggggaga
attggcattcgtgataaaggccaactcttgaaagtggaaagtttgcttaatggggaaacg
tgttttaacttccaagggatattcacacatttcgcgacggccgatgaaataaagaccgac
ttttatgaaaagcagcttgcttcatttaaaggaatgctttccgccttgatcagaaggcca
gaatatattcatgcagccaatagtgcagcttctttaaggtttagcgatcctgaatcgaat
gcgataagaatggggatttccatgtatggtttgagtccttctatggaaatgaagccgata
ttgccatttccattaaagcaggctatatcattgagaacgaagatggttgcagttaaacag
cttacaaagggtgaaagcgttagttatggagcaacatatacggctgaaggtgatgaatgg
attgggactttgccgattggttatgctgatggctggatccgtaagctgcaaggtcaggaa
gttcttgtggatggaagcagagtgccgattgtcggcaggatttgcatggatcaatgcatg
gtcaagctgcctcgatcataccctgtaggaacagaggtcacactcattgggaacgatgga
gatgaatcgattacagttgatgaagtagcggctaaactggaaacgatcaattatgaggta
acgtgtatgataggagcaagagtgccccgcgtatatataaaagacaatcagttgattcat
gttcgtaacttcatcctggaatga

DBGET integrated database retrieval system