KEGG   Bacillus simplex: UP17_11020Help
Entry
UP17_11020        CDS       T04304                                 

Definition
(GenBank) thioester reductase
Organism
bsj  Bacillus simplex
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C Thioesterase BDM
Motif
Other DBs
NCBI-ProteinID: AMM92984
UniProt: A0A127D7L4
LinkDB All DBs
Position
2351139..2366009
Genome map
AA seq 4956 aa AA seqDB search
MRSDLLAKLDSLSPEKREWLQKQMQKKEKETLPLSYAQQRLWFMDRFNPNSSLYNIPTVW
RLKGHWLPGALEKGLNRLIERHDSLRTVFKEVGDQPVQHIVEYLPGKLPVEDYSHLPLEV
KEKEIESLIAREAQEPFDLMNGPLIRNQLVQLGKDEWLLLCTMHHIISDAWSIGILINEL
LAFYEEETSGKPAGLNSLSIQYADFAKWQKQWLQGEVLDRQLTYWQEELSGELPILQLPL
DCPRPVTQTYAGDTCRVIVPHTLLSALKNLSQREGSTLFMTLMAAYQSFLARYTGQNDIL
VGSPIANRNHKGVEELIGFFVNTLVYRADLNGAPTFQEILSQIKKKALKAYEYQDIPFEK
VVEAVQPERSTSHSPIFQTMFTLQNIKQERLELSGRSLEMIESNISIAKFDLSLTAYEVE
EDLHVTFEYNTDLFDSRTIARMAGHFENWLNEIVHHPDESYTNLTMLSDTEQKQLLEEWN
DTDAVYAHESMIHELFEQQVARTPEAVAVVYEGGQLTYQELNEKANKMAHYLQKRDIGPE
SLVGICFERSPDMMIGLLGILKAGGAYVPLDPSYPENRLRYILKDSQIQVLLTKEALQGW
LPEGIQAICLDRDQAAISKESGLAPVSGVTAKNLAYIIYTSGSTGNPKGVMIEHHSVINR
LQWMQKNYPLSEQDTILQKTPFSFDVSVWELFWWSFVGARVCLLPPGGEKDPAMIEECIE
RYRVTTMHFVPSMLSAFLDYMEKSKAKKDVSSLCQVFTSGEALNSEQVRRFKGVFYDFQQ
TKLSNLYGPTEATVDVTYYNCDLEKELMLIPIGRPIDNTDLYVLDQNQQVVPVGVAGELY
LGGVGLARGYFNRPELTAERFIPHPFKEGERLYRTGDLVRYLNDRNLEYIGRVDNQVKIR
GFRIELGEVEAVLHDHPSVKEAVVLVREDHPGDKRLVAYVVGEGNTGEWREHLKAQLPNY
MVPAYFVEMEAMPLTPNSKIDRKALLALEGQSVSADIVLPRTPGEELIASVWSQVLGIGN
IGVQASFFELGGHSLLATQVVSRLQEVFQIELPLRELFEYSTVEALAKRLDQLRKGDKKR
EIPPLMPMERGDAIPLSYAQQRLWFIDQFTPNSALYNMPMVCRLTGNWVPEALEKGWNQL
IERHESLRTVFHEVDGHPVQQIQPHAFRSLSQMDLTMLSPEERESEVKRLLQQETEVPFD
LEEGPLIRTILLRVGEEEWVLLCTLHHIVSDGWSMGVLLEEWIAFYKEAMGEKEAELEPL
PIQYADFAQWQKGWLKEEVLEQQLHYWQEELSGELPLLQLPMDRPRPAVQTHRGSTHTVL
LSRSLRDKLNEISRQEGSTLFMTLLAAYQSFLSRYTGQEDILVGSPIANRNYRESEGLIG
FFVNTLVYRADLSGTPTFQDILSRVRQKALNAYEYQDIPFEKVVEVVQPERSTSHSPIFQ
TMFILQNMKQELPVLADRRIEMIESHSPIAKFDLSVMAAETEEGLLFAFEYNKDLFDVTT
IERMAGHFETWLNEVSHHPQKPLNSLGMLSEFERDLLVETWNDTAMEMSQVGLICDGFED
QVARRPGAIAVVDQMREWTYGELDARANQLAHVLQRKGVVPESVVGVYLPRSAELMASLL
GILKAGGAYVVLDPLYPKSRLQYMIEDAGVQIVVTTAAQESLSEQVETVRLEEITDESVI
APKRRVKPEHLAYIVYTSGSTGKPKGVMVEYRSLMNMVSWHQAVYQITAQDRATQIAGIA
FDSAVQEIWPYLTAGAALYLSTEELRINPEALRDWLIDSRITASFAPTPILERLLKLSWP
EKTDLRFIITGGDQLTQYPSEQIPFAVINQYGPSENTVVATDCYVPVGMSTGTPSIGRPI
ANTEVYVLDSHLQPVPVGVIGDLYIGGKSLARGYANRPELTEEKFILHPFKSGERLYFTG
DKASYLPGGDLQFHGRMDDQVKIRGFRIELGEVEATLQAHLSVKEAVVLVREDHPGDKRL
VAYVAGEGSVHEWREHLQTHLPNYMVPAHFVEMAFLPLTPNGKLDLKALPMPDEPSTENT
VYPRTLMEELIASVWSQVLEMENIGVQASFFELGGHSLLATQVVSRLKEALQIELLVREL
FEHSTVEALAKRLDQLCKGDKKREIPPLIPMERGEAIPLSYAQQRLWFIDQFQPNSALYN
MPMVCRLTGNWVPEALETGWNRLIERHESLRTVFHEVDGQPVQQIQPYALRSLPKMDLTT
LSPEEREREMEQWIKNEVEAPFDLVQGPLIRGQIVQIAEEEWILLCTMHHIISDGWSMEI
LLQEWMAFYEDAVGGKPAELAPLPIQYADFAQWQREWLKEEVLDRQLAYWKEELSGELPV
LMLPIDRPRPAVQTHSGSTHTVLLSRALRDKLNELSRQEGSTLFMTLLASYQSFLSRYTG
QSDILVGSPIANRNYREIEGLIGFFVNTLVYRADLSGAPTFQELLSQVRTKALKAYEYQD
VPFEKIVEVIQSERSISHSPIFQTMFTLQNTKHELPELHGRSLEAMEIQDSNAKFDLSLS
AIEKEEGLILSFVFNTGLFDVVTIRRMAEHFEKWLNEIVEHPDKSLAKLTLLPEMERQLL
EEWNDNAETYPRESVIHRLFEDQVDLTPDTVAVVDENQQLTYRELNEKANQLAHYLQKCG
VGTESLVGLCFQRSVEMIVGLMGIWKAGAAYVPLDPLYPESRLRYILQDTGIQVLVTNEA
LKEWIPEEVEAVCLDRDQAMISRESTLSPICEVAGENLAYVIYTSGSTGNPKGVLVQHHS
VLNLSYGLQKEVFSHETPVNMRVGLNASIAFDVSIQQLQMLLYGSSLYIIPDEVRSDPQQ
FVSYIRENKLEMFDMTPSLLQLLIDGGLLETNDGVHVPSKVLVGGEAIVPSLWEQLVEAD
KIHFYNVYGPTECTVDATCYRIKKDGKRVTIGRPLPNVQAYVLDGNWLPVPVGVTGELYI
GGAGLARGYLNRPELTSERFIPHPFKEGERLYRTGDLVRHLPDGNLDYLGRLDNQVKIRG
FRIELGEIEATLQEHLSVKEAVVMVREDQPGDKRLVAYVVGEGRKEEWREYLKAQLPSHM
VPAYFVGMEELPLTLNGKIDRKTLPVPDHQGTKGGYVAPRNESEQILTMIWERVLGTKPI
GIHENFFEIGGDSILSIQIVSRARQAGLQLTPKQMFEHQTISELAQVVKEEQGVQAEQGV
VTGELILTPIQQWFFAQDHPNPHHWNQSMFFRTKERLDIVLLEKAVRTLLIHHDALRLRY
ERFPDGAWKQRNEGIEEHSTLTVISLEEVPQAEWHQVIQAEIDTAQASLHLHAGPLMRMV
YFDEGEKRAGRLFWVIHHLAVDGVSWRILLEDLQTAYNQASHAQMIQLPTKSTSFKAWSE
KLHHYAEAGIVQGVRDYWEQQSEQEVAMLPVDTTLEVPANTGTEEITVVLDEKETRALLQ
EISSTHRVQINEVLLTALVQATAAWTGHTTLTVDLEGHGREEIIEDVDLSRTVGWFTSIY
PVHLNITGANTPTAALKAVKEQVRQIPNKGVDYGILRYLNPAMRERFQSQITPSISFNYL
GQFDQMFSDDAMFAPETGFTRLDHAPGSKRSHLIDVIGIVTDGKLHFTWVYNVGQFAEST
IQSVAENMLHQLSGLIHSSGGESTLTVSDFAIANLIPADLNKVLCKMNRGKNYPIIDLYP
LSPLQEGMIFHTLHDQGDEHSVPYMVQLSFLFKGKLDILTFEQAWKSTIQRHEIFRSAFV
WDEIENPLQVVYAHIPFKLNEVDWSALSAEEKEEKRKAFLATDRKQAFLFDEAPLMRVTV
IQEAEDEYRVVWTHHHILLDGWSLPLVFNELLTVYQKRIKGEAVDLPKSPLYKKYIQWLK
VQDLEQAEQFWREKLKGFTAPTLLGLESKEQEKGYTEKVTYLSEEQTQALQNWAKRKRLT
LNTVIQGAWAYLMSRYSGEDDIVYGVTSSGRPTEIIDVENIVGPFITTSPTRIKLLDDIK
VMDWLQKIQEEEIERRQYEYASLTDIQGWSEVPRGTPLFHSLYVFENYPVKEESSGNLEI
GELEGVEQTHYPLGLTVVPESQLLLKLKYDRSKFNGLTIERMLGHLSQVLKQMIENVDQT
LSELVYVTEIEKKQLLEEWNDNAAAYPRESVIHKLFEDQVDRTPDTVAVVDENQQLTYRE
LNEKANQLAHYLHKCGVGTESLVGLCFQRSVEMIVGLMGIWKAGAAYVPLDPAYPESHLR
YILEDTGIQILVTNEVSQGWIPEEVETVYLDRDQAMISQENTLSPICKVTGENLAYVIYT
SGSTGNPKGVLVQHHSVLNLSYGLQKEVFSHETPVNMRVGLNASIAFDSSVKQLQMLLYG
SSLYIIPNEVRSDPQQFVSYIRENKLEMFDITPSLLQLIIDEGALETNDGVHVPSKVLVG
GEAIMPSLWEQLVEADKVHFYNVYGPTECTVDATCYRIKKDSKRVTIGRPLPNVQAYVLD
GNWLPVPVGVTGELYIGGAGLARGYLNRPELTSERFIPHPFNDGERLYRTGDLVRYLADG
HLDYLGRIDNQVKIRGFRIELGEIEANLECHPSVKEAVVLIREDQPGDQRLVAYVVGEGN
MHEWREHLKRQVPNYMVPAHFIEVDAVPLTTNGKVDRKALNSLTIQRESTFSTPIIPRDE
IEYQLITIWQDLLQIEDVHVNDDFFDLGGHSLLVIKLISKVREKFGKEIKVSALIKNPTV
EGIAYLIRENHGMAKSLSVLVPLQESEKRPFFCVHPFMGNVFCYIQLARLLKDHCSFYGL
QNPLVEKEGMNGLTLSEVVQLYIEEMKRAQPVGPYRLGGWSLGGAIAYEIATMLRNQGEE
VEVLVLMDTKVPSEQDYKAEDEMLSYILEHFSHLELVEQEEELVHQQGMLVDQLIAEGVL
RPDADLTSLKQITDAHRKCLNLMAEHILTPYFGEVIYFSAEEGRELFTDWKPLLQGKVNK
HSVPGPHEEIVFSPAVEKIAKSLVNEFEGSVTQISR
NT seq 14871 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtgatttacttgcgaagctggattcgctttctcccgagaaaagggagtggctt
cagaagcagatgcaaaaaaaggagaaagaaacgcttccgttgtcctatgctcaacaacga
ttatggtttatggaccgatttaacccaaacagttcattatataatattccgacagtatgg
cgtctgaaagggcattggctacctggagcattggaaaagggattaaatcggctcattgag
cgtcatgattcattacgcaccgtttttaaggaagtaggagaccaaccggtacaacatatt
gtggaatatcttcctggaaaactacctgtagaggattattctcaccttcctctggaagta
aaggaaaaagagatagagagtttgattgcaagagaagcgcaggagccatttgatttaatg
aatggccctttgatccgcaatcaactagttcaattagggaaagatgaatggttattgcta
tgtaccatgcaccatattatttctgatgcgtggtccatcggcatattgatcaatgaattg
cttgccttctatgaggaggaaacgagtgggaagcctgctggactaaattcgctatcgatt
caatatgcagactttgcgaaatggcaaaagcagtggttgcagggtgaagtgttggatcga
caactcacgtattggcaggaagaattgtccggtgagcttcctatattacaactgccgttg
gattgccctagaccggttacgcaaacgtacgctggggacacatgtcgtgtgattgtacct
cacacactactaagtgcattgaagaatttaagtcagcgagaaggatccaccttattcatg
accttaatggccgcgtatcagagctttcttgctcgctatacggggcaaaatgatattctc
gtcggaagtccgattgcgaatcggaatcataaaggagtagaggaattaatcggcttcttt
gttaatacgttagtctatcgggcggacctgaatggggctcctacgttccaggagattttg
tctcagataaagaaaaaggcgttgaaggcatatgaatatcaagatattccgtttgaaaaa
gtggtagaagcggtacaacctgaacggagcactagccattcgcccatcttccagaccatg
tttacgctacagaatataaaacaagaacgattagagctgtctgggagaagtttggaaatg
atagaaagtaatatctccatcgcgaaatttgatttgagtctaaccgcgtatgaggtggag
gaagacctacatgtcacttttgagtacaatacagatttatttgacagtagaaccattgca
cgtatggcggggcattttgaaaactggttgaacgaaatcgttcatcatccagatgaatca
tatacaaacctgacgatgctatcggacacagagcagaagcagctcttggaagaatggaat
gacacggatgcagtttatgcacatgagagcatgattcacgaactgtttgaacagcaggtt
gcgcgtacacctgaagcggtggcggtagtatatgaaggtggacagctgacgtatcaagaa
ctcaacgagaaagcgaacaaaatggcccattatttacaaaaacgggatataggtcctgaa
tcattggtcgggatatgtttcgagcgttcacccgatatgatgattggtctcttaggaatt
ctcaaagccggcggggcttatgtcccgctggatccgagttatcccgaaaatcgcctgaga
tacatattaaaggactcacagatccaagtgcttttaacgaaggaagctctacaaggttgg
ttgcccgaagggatccaagcgatttgtttggatcgggatcaagcagcgatttctaaagag
agtggattggcgccagtgagtggagtgacagcaaaaaacttggcgtatatcatttacact
tcgggttcgacagggaatccgaagggagtgatgatcgaacaccactcggttatcaaccga
ttacagtggatgcaaaaaaactatccattatctgaacaggatacgattcttcaaaaaacg
ccgttttcgtttgatgtctctgtctgggaattattttggtggtcatttgtaggagcgcgt
gtttgtttacttccgccgggtggagagaaggatcctgcaatgattgaggagtgcattgag
cgatatcgtgtgaccacgatgcactttgttccgtcgatgttatctgcattcttggattat
atggaaaaatccaaagcgaaaaaggacgtatcgtctttgtgtcaggttttcactagtgga
gaagcgttaaattccgaacaggttcgccggtttaagggtgtattctatgattttcagcaa
acgaagttaagcaacttgtatggtcctaccgaagcgactgtagatgttacttactataat
tgtgatttagaaaaagaactgatgctcattccaattggtcgcccgattgataataccgat
ttgtatgtattggatcaaaaccaacaggtggtacctgttggtgtggctggggaactttac
cttggtggtgttggcttggcacgtggttacttcaatcgtccagagttaactgctgaacgt
tttattccgcatccatttaaggaaggggaacgactctatcggaccggggacctggtgagg
tatctgaatgaccgcaacttggagtatatcggcagagtagataatcaagtgaaaatcaga
ggcttccggattgagttgggagaggttgaagcggtcctacatgatcatccatctgtgaaa
gaggctgtcgtgctggtaagagaagatcatccaggagacaagcggttagtagcatatgtg
gtgggtgaaggaaacactggagaatggcgcgagcacttaaaggcgcaattaccgaattac
atggtcccggcatactttgtcgaaatggaagcgatgcccctcactccgaatagcaaaatc
gatcgcaaagccttactggcattggaaggacagtccgtgagtgccgatattgtcttgccg
cggacaccaggggaagagctcatcgcgtctgtatggagtcaggtgttaggcataggaaat
attggtgttcaggcttccttcttcgaacttggtggccactcgctactcgctacccaagtt
gtctcacgtttacaagaagtcttccaaatcgaactaccgttgcgtgaactatttgagtat
tcaacggtggaggcactggcgaagcgactggatcagttgcgtaaaggagacaaaaaacgg
gagattccaccgcttatgccgatggaacggggggatgccattccgctctcttatgcccaa
cagcgcctgtggttcatcgaccaattcacgcccaatagtgcactttataatatgccgatg
gtttgccgtcttacagggaattgggtacccgaagcattggagaagggatggaatcaactg
atagaacgtcatgaatctttacggacagtgttccatgaagtggatggtcatcctgtacag
cagattcaaccgcatgcttttcggtccctttctcaaatggatttaactatgctttctccg
gaagagcgagaatcggaagttaagcgtttgttgcagcaagaaacagaagtgccatttgac
ctagaagaaggcccactgattcggacgatcctcttgcgagtgggagaagaggaatgggtc
ctcctctgcaccctgcatcatatcgtttcggatggatggtcgatgggagtcctccttgaa
gaatggatagctttctataaggaagcaatgggtgagaaggaagcggaacttgaaccttta
ccgatccaatatgcggactttgctcagtggcaaaagggatggttgaaggaagaagtactt
gaacagcaactccactattggcaggaagaattgtctggtgagctgcccttgctacaactg
ccgatggatcgccctcgtcctgcggtacaaacccatcgcggatcgacacacactgtgttg
ttgtcacgttcattacgcgacaaactgaacgaaatcagtcgtcaagaaggatcgactctc
ttcatgaccctattggctgcgtatcaaagcttcctctcccgttatacaggacaagaagat
attctcgtcggaagcccaattgcgaatcgtaattacagagagagtgaaggattaatcggc
ttcttcgtgaatacgctggtctatcgggctgacctgagtggtacaccgaccttccaggat
atattgtctcgggtgcgtcaaaaggcactgaatgcatacgaatatcaagatattccattt
gaaaaagttgtggaagttgtgcagcccgagcggagtacaagtcattctccgatcttccag
acgatgttcatcttacaaaatatgaaacaagagcttccggtgttggctgatagaaggatc
gaaatgatagaaagccacagtccgatcgcgaagtttgatttaagtgttatggcagcagag
acggaagaaggattattgttcgcttttgaatacaataaggatttatttgatgttacaacc
atcgaacgaatggcaggacattttgagacatggctaaatgaagtttctcatcatccacaa
aaaccgttgaatagtcttggtatgctatccgaatttgagcgtgatttgttagtagagaca
tggaatgacaccgcaatggaaatgtcccaagtgggtcttatttgcgacggatttgaggac
caagtagcacgacgtcccggtgcgatagcagtggtcgatcaaatgagagagtggacctat
ggtgaactggatgcgcgagcaaatcagttggcacatgttttgcagagaaaaggggttgtc
cctgaatcagttgtgggcgtctacctcccgagatcggctgagctcatggcaagtttactt
ggcatattaaaagctggcggggcctatgtcgtcctagatccgttgtatccgaaatcacgg
ttacaatacatgattgaagatgcaggggtccaaatcgtggtgacgacagcagcgcaagaa
agcctttccgaacaggtcgaaacggtgagattagaagaaataacagatgaaagcgtgatc
gcaccgaagcggcgggtaaaacccgagcatttagcttatatcgtctacacctctggctcc
acaggaaagccaaagggtgtcatggtcgaatatcggtcattgatgaatatggtttcttgg
catcaagcggtataccaaattacagcacaggatcgtgcgactcagattgcggggattgcc
tttgactcagctgtccaggagatatggccttatctcactgcaggtgcagcactataccta
tcaacagaagagttgcggatcaatccagaggctctaagagattggctcattgattcacgt
atcacggctagctttgcgcctacacctatactcgaaagactcttgaaattatcttggcca
gagaagacggatctccgttttatcattacgggaggggatcagttaacacagtatccatct
gaacaaatcccttttgcggtgattaatcagtatggtccatcggaaaataccgtcgttgcc
actgattgttacgtgcctgtaggaatgtcaacaggtactccgtctattggtcggccgatt
gcgaatacagaagtatacgtgttagattcacaccttcagccggtgccggtgggtgtgatt
ggagatctctatatcggaggaaagagccttgctcgcggctatgccaatcgtccggaactc
acagaggaaaaattcattctgcatccgttcaagtcaggggaacgtctctatttcaccggg
gacaaagcaagttatcttcctggcggtgatctccaattccatggtcgtatggatgaccaa
gtgaaaattcgcggtttccggattgaactgggagaagttgaagcaacgctgcaggcgcat
ttgtctgtgaaggaagctgttgtcctggtgagagaggatcatccaggagacaagcgattg
gtagcttatgtagctggtgaaggaagtgttcatgaatggcgggagcatctgcaaacacat
ttaccgaattacatggttccggcacactttgtcgagatggcatttttaccactcacacca
aatggaaaactcgatttgaaagcattacctatgcctgatgaaccatctactgaaaatacc
gtatacccaagaactctgatggaagagctcatcgcttcggtatggagtcaagtactggaa
atggaaaatattggtgtgcaggcttccttcttcgaacttggtggccactcgctacttgct
acgcaagttgtctcccggttaaaagaagcattacaaatcgaactgctagtgcgtgaactg
tttgagcattcaacggtggaggcgttggcgaagcgactggaccaattgtgtaaaggagac
aaaaaacgagagattccaccgcttataccgatggaacggggagaagccattccgctctct
tatgcccaacagcgcctgtggttcatcgaccaatttcagcccaatagtgcactatataat
atgccgatggtatgccgtcttacagggaattgggtacccgaagcattggagacgggatgg
aataggctgatagaacgtcatgaatctttacggacggtattccatgaagtggatggtcaa
cctgtgcagcagatacaaccgtatgctctccggtcccttcctaaaatggatctaactacg
ctttctccggaagagcgagaaagagaaatggaacaatggatcaaaaacgaagtcgaagca
ccatttgacttagtgcaaggtccgttgattcgtgggcaaatcgtgcaaatcgctgaagaa
gaatggattcttctttgtacgatgcatcatattatctctgatggctggtcgatggaaatc
ttgctccaagaatggatggcattctatgaagatgcggttggcggcaaaccagcagaactc
gcaccattaccgattcaatatgctgactttgcccaatggcaaagggaatggttaaaagaa
gaagtacttgatcggcagcttgcatattggaaagaagagctgtctggcgagttaccagtc
ttaatgttgccgattgatcgtcctcgtcctgcggtgcaaacccatagcggatcgacacac
actgtgttgctgtcacgcgcgttacgcgacaaattgaatgagcttagtcgtcaagaagga
tcgacgctcttcatgaccttacttgcatcgtatcaaagctttctctctcgttatacagga
caatcagatattcttgtcggaagcccgattgcaaatcggaattatcgcgagattgaagga
ttgattggtttcttcgtcaacactttggtttatcgggctgatctgagtggcgcaccaaca
ttccaagagttgctgtctcaggtacggacaaaagcattgaaggcgtatgagtaccaagat
gttccgtttgaaaagattgtagaagtcatacaatccgagcgaagtataagtcattctcca
atcttccaaaccatgtttacgttgcaaaacacgaaacatgagctaccagagcttcatgga
agaagtttagaagcgatggaaattcaggattcgaacgccaagtttgatttgagtttaagc
gccatagagaaggaagagggtttgatcctttcttttgtctttaatactggcttatttgat
gttgtaaccatcagacgtatggctgagcattttgaaaaatggttgaatgaaatcgtggaa
catcccgataaatcactggcgaagttgacgttgctaccggagatggagaggcaattgctg
gaagagtggaatgataatgctgaaacgtatccacgtgagagtgtgatccacagacttttt
gaagatcaagtggatcttacacctgacacggtggcggtagtggatgaaaatcagcagttg
acgtatcgggagctgaatgaaaaagcaaaccaattggcccattatctccaaaaatgtggg
gttgggaccgaatcattggtagggctttgtttccaacgttcagttgagatgattgtcggt
ctaatgggaatctggaaagctggggcagcctatgttccgttggatccattgtacccagaa
agtcgcctgcgatatatcctgcaggacacagggattcaagtattggtcacgaacgaagca
ttaaaagagtggatacccgaagaagtcgaagcagtttgtttggatcgagatcaagcgatg
atctcgcgagaaagtaccctttcaccaatatgtgaagtggcaggagaaaacttggcatat
gtgatctatacatcgggttcgaccgggaatccaaagggcgttttggtgcaacatcattcg
gtactaaatctatcatatggtctacagaaagaggttttttcgcatgagacacctgttaac
atgcgtgtcggtttaaatgcttcgatcgcctttgatgtatccattcagcaattacaaatg
cttttgtatggttcaagtttgtatattattccggacgaagttcgcagtgatccccaacag
tttgtatcctatattcgggagaataagttggaaatgttcgatatgactccttcattactc
caattactcatagatggcgggttgttagaaacaaacgatggtgttcatgttccaagcaag
gtactggtcggtggcgaagcaattgtaccgtcactgtgggaacaattagttgaggctgac
aagatccatttttataacgtgtatggtcctacggaatgtactgtcgatgctacatgctat
cgtatcaaaaaagatggtaagcgagtaaccattgggcgtccgttgccgaacgttcaagcc
tatgtattggatgggaattggttacctgttccagttggtgtaacgggtgaactttatatc
ggtggagcaggtctagcgagaggatacttgaatcgtccagagttaacgtccgaacgtttt
attccccatcctttcaaagaaggagagaggctatatcgaacaggagatctcgtgaggcac
cttcctgatggtaacttggattatctaggaagattggataaccaagtgaaaattagagga
tttcggattgagcttggggaaattgaggcaaccttacaggagcatctctcggtaaaagag
gccgttgtgatggtgagagaagatcagccaggagataagagattggtagcctatgtagtg
ggtgaagggcgtaaagaagaatggcgcgagtatctcaaagcacaactgccaagccatatg
gttcccgcctactttgtcgggatggaagagttaccattgaccttaaatggaaagattgat
cggaaaactttgcctgtgccagatcatcaagggacaaaaggaggctacgtggctccaaga
aatgagagtgaacaaatacttaccatgatatgggaacgtgtgttaggcacaaaaccgatt
ggcattcatgaaaacttttttgaaatcggtggagactcgattctcagcattcagattgtc
tctcgcgcaaggcaagcaggtttgcaattgacaccaaagcaaatgtttgaacaccaaacg
atttccgagttggcgcaagtagtcaaagaagagcagggtgtacaagcggaacaaggagtc
gtaactggagaactgatccttacaccaatccagcaatggttttttgcacaagatcatcct
aacccacatcattggaatcaatccatgttttttagaacaaaagagcgtctggatatagta
ttactggagaaagctgtccgtacccttctaatccatcacgatgccttgcgtttaagatat
gaacgttttccggatggagcttggaaacagcggaacgaagggattgaagaacactcgact
ctgaccgtgatttcattagaagaagtgccacaagcagaatggcatcaagtaattcaagca
gagattgacactgcacaagcaagcttgcacttacacgcaggaccgctaatgagaatggtg
tattttgatgaaggcgagaagagagccggccgattattctgggtgattcatcacttagca
gtggatggtgtttcttggcggattttactggaggatctgcaaacggcgtataatcaagcg
agccatgctcaaatgatccaattacctacaaaaagtacatcctttaaagcgtggtcggag
aaattgcatcattacgctgaagctgggattgtgcaaggagtgcgtgattactgggagcag
caatccgaacaagaggtggctatgctaccagtggataccaccctcgaagttccagcaaac
acaggaaccgaggagattaccgtggtgctggatgagaaagagacccgtgcgttattgcaa
gagatttcaagcactcatcgtgtccaaatcaatgaagtgctattgacagcattggtacag
gctacggcagcatggacaggtcatacgacgctgaccgtggatttggagggtcatggccgg
gaagagatcatcgaagacgttgacctatcgagaaccgtgggatggtttacaagtatctat
cctgttcacttgaatattacaggtgctaacacgcccaccgcagcattaaaagcagtcaaa
gaacaagtgcgccaaattcctaataagggcgttgactatgggattttgcggtacttgaat
ccagcgatgcgtgagcgattccagtctcaaatcactccgtccattagttttaactatctt
ggacaatttgaccaaatgttctctgacgatgcaatgtttgctccggagaccgggtttacg
cgcttagatcatgctcctggttccaagcgatcacatttgatcgatgtaatcgggattgta
accgatggaaaacttcatttcacttgggtgtacaatgttggacagtttgcggagtcgacc
attcaaagtgttgccgagaatatgctccatcaactgagtggattgattcattcttcgggt
ggagaatctacgctgaccgtttcggattttgcgattgcaaatctcatcccagcagatttg
aacaaagtactatgtaagatgaatcgtggaaagaattatccgattatcgacctgtatccg
ctatcacctttgcaggaaggcatgatctttcatacgctgcatgatcaaggggatgaacat
tccgtgccgtatatggtgcaattaagtttcctgtttaaagggaaattggatattcttact
ttcgagcaggcgtggaaatcgacgatccagcggcatgagatctttcgttcggcatttgtg
tgggatgagattgaaaatcctttacaagtggtgtatgcacatatcccatttaagctgaat
gaagtggattggagtgcgctgtctgctgaagaaaaagaggagaaacgaaaagcctttttg
gcgacggatcgaaaacaggcctttctttttgatgaagcgccattgatgcgggtgactgtc
attcaagaagcggaggatgaatatcgggttgtttggacgcatcaccatattttgttggat
ggatggagcttgccactggtctttaacgaattgcttacagtgtatcagaagaggataaaa
ggagaggctgtggatttacccaagtcaccgctatacaagaaatatattcaatggctgaaa
gtgcaggatctggaacaagcggaacaattctggagagagaaactcaaaggctttacagcg
ccaaccctgcttggcttagaaagtaaggagcaagaaaaaggttacacggagaaggtaact
tatttatcagaagagcaaacccaagcgctacaaaactgggcgaagcgaaagaggctcact
ttgaacacggtaattcaaggtgcgtgggcgtatctcatgagccggtatagtggagaagat
gacattgtctatggtgtaactagctcgggacgccctacggagattattgatgttgaaaac
attgtaggtccctttattaccacatcaccgacgcgaattaagttgctagatgatataaaa
gtaatggattggttgcagaagatacaagaggaagagatagaaagaagacaatatgaatat
gcttcattgacagatattcaaggatggagtgaagttcctagaggaaccccgctgttccat
agcttgtatgtgtttgaaaactacccagtgaaagaggagtcttcaggaaatctagaaatt
ggtgagttggaaggagtagagcaaactcattatccattgggattgacggttgttccagaa
agccagttgttgttaaagttgaagtatgatcgcagcaagtttaatggcctaaccattgaa
cggatgctgggtcatttaagccaggtgttaaagcaaatgatcgagaacgttgatcaaact
ctgtcggagctggtgtatgttacggaaatagaaaagaaacaactactggaagaatggaat
gataatgccgcagcatatccacgtgagagtgtgatccacaaactgtttgaagatcaagtg
gatcgtacacctgacacggtggctgtagtggatgaaaatcagcagttgacgtatcgggag
ctgaatgaaaaagcaaaccaattggcccattatctccataaatgtggggttgggaccgaa
tcattggtcgggctttgtttccaacgttcagttgagatgattgtcggtctcatgggaatc
tggaaagccggggcagcttatgttccattggatccagcgtatccagaaagtcacctgcga
tatattctggaggacacagggattcaaatattggttacgaatgaagtatcacaaggttgg
atacctgaagaagttgaaacagtttatttggaccgggatcaagcaatgatttcgcaagaa
aacaccctttcaccaatatgtaaagtgacaggagaaaacttggcgtatgtgatctacact
tcaggttcgaccgggaatccaaaaggggttttggtgcagcatcattcggtattaaatcta
tcctatggtttacagaaagaggttttttcgcatgagacacctgttaacatgcgcgttggt
ctgaatgcctcaatcgcctttgattcatccgttaaacaattacaaatgcttttgtatggt
tctagtttgtatattattccgaacgaagttcgcagtgatcctcaacagtttgtatcttat
attcgggagaataagttggaaatgttcgatataactccttcactactccaattaatcata
gatgagggggcgttagaaacaaacgatggtgttcatgttccaagcaaggtactggttggt
ggagaagcgattatgccatcactgtgggaacaattagtagaggctgacaaggtccatttt
tataacgtgtatggtcctacggaatgtactgtcgatgcgacatgctatcgtatcaaaaaa
gatagtaagcgggttaccattgggcgtccgttgccgaacgttcaagcctatgtattggat
gggaattggttacctgttccagttggtgtaacgggtgaactttatatcggtggagcaggc
ctggcgagaggatacttgaatcgtccagagttaacgtccgaacgttttattcctcatcca
tttaatgatggggaacggttataccggacgggagatctagtccgctatttagctgatggc
catttggattatctgggaagaatcgataatcaagtgaaaattcgaggattccggattgag
cttggagagattgaagcgaatttagaatgtcatccatcggtgaaagaggcagtagtcttg
ataagagaggaccaaccaggagatcagagattggttgcctatgtggtgggtgaaggaaat
atgcatgaatggcgtgagcatctcaagagacaagtaccgaattatatggttcctgcacac
tttattgaggtagacgcggttccgcttacaacaaatgggaaggttgatcgaaaggcactg
aacagcttaacgattcaaagagaaagtaccttttctacaccaatcatcccacgggatgaa
atcgagtatcagctgattacgatctggcaggatttgctacagatagaagatgtccatgta
aacgatgatttcttcgatttagggggtcactctctccttgtaatcaaattgatttcaaag
gtcagagagaaatttggaaaagagattaaggtgtccgcactgattaagaacccgacagtg
gaagggatcgcttatctcatccgtgagaatcatggtatggcaaaatcgttatcggttctg
gttccactacaagaatcagagaaaagacctttcttctgtgttcatccgtttatgggtaat
gtattctgttacattcagctagcaaggttactcaaggatcactgctcattttatggtcta
cagaatcctctcgtagagaaagaaggaatgaatgggttgactttatcggaagtagttcaa
ctctacatcgaggaaatgaagcgcgctcagccagtggggccgtatcgtctgggaggatgg
tctctgggcggtgccatcgcctatgaaatcgcaactatgctacggaaccagggagaagaa
gttgaggtgttggtactcatggataccaaggtgccttcagaacaggattacaaggcagag
gatgaaatgctatcttatatattggagcatttcagccatttagagctagtggagcaggaa
gaagagctcgtccatcaacagggcatgcttgttgatcagttgatcgcggaaggagtgctc
cggcccgatgcggatcttacgagtctaaagcagattaccgatgctcacaggaagtgtcta
aatttaatggcagaacatattttaacgccatattttggggaggtcatctacttcagtgct
gaagaaggcagagagttgttcacggattggaagccgttattacaggggaaagtgaataaa
cattcggttccagggccgcacgaggagatcgtcttctccccagcagtggaaaagatagcc
aaaagtctcgtaaatgagtttgaagggagcgtaactcagatttccaggtga

DBGET integrated database retrieval system