KEGG   Bacillus simplex: UP17_13990Help
Entry
UP17_13990        CDS       T04304                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bsj  Bacillus simplex
Pathway
bsj00020  Citrate cycle (TCA cycle)
bsj00310  Lysine degradation
bsj00380  Tryptophan metabolism
bsj01100  Metabolic pathways
bsj01110  Biosynthesis of secondary metabolites
bsj01120  Microbial metabolism in diverse environments
bsj01130  Biosynthesis of antibiotics
bsj01200  Carbon metabolism
Module
bsj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UP17_13990
  Amino acid metabolism
   00310 Lysine degradation
    UP17_13990
   00380 Tryptophan metabolism
    UP17_13990
Enzymes [BR:bsj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     UP17_13990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AMM93443
UniProt: A0A127D939
LinkDB All DBs
Position
complement(3025888..3028740)
Genome map
AA seq 950 aa AA seqDB search
MTIKDAKAYDPWKTFSGPNLGYVMEQYDLFQANPEEVDPELKNFFEVSGPPSFDVSAETT
IVSAPTVQTGEVLPMKKIMSAVTLAENIRAYGHLAANIYPLKEEALDTEQIHFEKYGLTA
DDLRKIPAELICPESPENVKDGYEAVQYLKQLYTKTIAFEFHHVNDLDEKQWLTDMVESG
KMFPEVAKEKKELLLKRLNEVEGFEKFLHRTYVGQKRFSIEGLDALVPILDEMISQTVQN
GTGNVNIAMAHRGRLNVLAHVLGKPYEVIFSEFQHSPNKDLVPSEGSTGINNGWTGDVKY
HLGLDKQITNANIQKARVTLANNPSHLEVVGPIVEGYSRAAQEDRSEKGFPVQDISKSLA
ILIHGDAAFPGEGIVPETFNLSRLRGYQVGGAIHIIANNMIGFTTESEDSRSTLYASDLA
KGFEVPIVHVNADDPEACMAAVNLANLYREKYNKDFLIDLIGYRRFGHNEMDEPLVTQPE
MYALIHKHQTVKELYGKKLIQSGEFTEAEVKAIAEQVDTRLADAYAKISGNKPEASKECN
PPGIIERGLPAIETAVPKQELVSINEELVKWPEGFTPNKKLGKILSRRLDSFGADGKIDW
AHAETLAFASILSDGTPIRLTGQDSERGTFAQRNIMLHDSVNGKTYSPLHTLETAKASFA
VHNSPLTETAVLAYEYGYNVFAPEALVLWEGQFGDFANTAQVIFDQFIAAGRAKWGQKSG
LVMLLPHGYEGQGPEHSSARLERFLQLAAENNWTVANLSSAAQYFHILRRQAKILDQEQV
RPLVIMTPKSMLRNQVMASTAEEFSEGSFESFVETKALGKKPKSVERIVFASGKLAVELR
EKAATEQKTDWLQIISIEEIYPFPFTGVQEALKKYTNLKEIFWAQEEPKNMGAWTFVEPR
LNAAAPGNLSVTYIGRKRRSSPAEGDPLVHKNEQQRIMTQAITRNNEGEK
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaaggacgctaaggcatacgacccatggaaaactttttcaggtccaaacctt
gggtatgtcatggagcaatacgatctatttcaagccaacccggaagaagtagatccggaa
ctgaaaaacttttttgaagtatcaggtcctccttcattcgatgtatcggctgaaacaaca
atcgtaagtgcaccaactgtacaaactggagaagttcttccaatgaagaaaataatgtct
gcagttacgttagcagaaaacatccgtgcatacggacatcttgcagcaaatatttatcct
ttaaaagaagaagctctagatacggaacaaattcactttgaaaaatatggattgaccgca
gatgatttaaggaaaataccggctgaattaatttgtccagaatcacctgaaaacgtgaaa
gacggatacgaagccgttcaatacctaaaacaactttatacaaaaacgatagcctttgaa
tttcaccatgttaatgacttggacgaaaagcaatggcttactgatatggtcgaatccgga
aaaatgttcccggaagtggctaaagagaaaaaagaactattacttaagcgattgaatgaa
gttgaaggtttcgagaaattccttcaccgcacatatgtggggcaaaaacgtttctccatt
gaaggactagacgccctagtgccgattttagatgaaatgatttcacaaactgttcaaaat
ggaacagggaatgtaaatattgccatggctcaccggggacgtttgaatgtgcttgcacac
gtactaggaaagccatatgaggtcattttctctgaattccaacattcacctaataaagat
ttggttccttccgaaggttcaacaggcattaacaacggatggactggtgatgttaaatac
catttaggtctggataaacagattactaatgctaacatacaaaaagcaagggttacactt
gccaataacccaagtcacttggaagtagtcggtccaatcgtggaagggtattctcgtgcg
gcacaagaagaccgttcagaaaaaggattccctgtccaagacatttccaaatcacttgca
atcctgattcatggtgatgcagcattcccaggtgaaggtattgttcctgaaacgtttaac
ttaagccgtttacgcggttatcaagttggcggcgctatccatatcatcgccaataacatg
attggtttcacaacggaaagtgaagattcacgttcaactctatatgccagtgatttggca
aaaggctttgaagtgccgatcgtacatgtgaatgcagatgatccagaggcatgtatggct
gcggtgaaccttgcgaacctatatcgcgaaaaatacaataaagatttcttgatcgacctg
atcggttacagacgtttcggccataacgaaatggatgagccattggtgactcaacctgaa
atgtatgcattaattcataagcaccaaactgtcaaagagctttatgggaagaaactcatt
caatctggtgagttcactgaagctgaagttaaagcaattgctgagcaagtggatacaagg
cttgcggatgcatatgcgaaaatttccggaaataaaccggaagcttctaaagaatgtaat
cctcctgggattattgaaagaggacttccagccattgaaacggctgttccgaaacaagaa
ctggtttcaattaacgaagaacttgttaagtggccggaaggattcactcctaataaaaaa
ttaggtaagattttatcacgtcgcttggattcctttggtgctgacggtaaaattgattgg
gctcatgccgagacactggcatttgcatccatattgagtgacggtactccaatccgtttg
acaggacaagactcagagcgtggaacattcgctcaacgtaatatcatgttacatgacagt
gttaatggaaaaacatattcaccacttcacacacttgaaactgctaaagcttctttcgct
gttcataacagcccgcttactgaaacggcagttctagcttatgaatatggttataatgta
tttgctccagaggcactagtattatgggaaggccaattcggtgacttcgcaaatacagca
caagtgatctttgaccaattcattgcggctggccgtgcaaaatggggtcaaaaatcaggt
cttgtcatgctgcttccacatggttatgaaggacaagggccagagcactcaagtgcacgc
ctagaacgtttccttcaattagcggctgaaaacaactggacagttgctaacttaagttcg
gcagctcaatacttccatatccttagaagacaagctaagattttggatcaagagcaagtt
cgtccgcttgtcatcatgacaccgaagagtatgcttcgtaatcaagtgatggcttctaca
gctgaagaattcagtgaaggctcttttgaatcattcgttgaaactaaagctttaggcaaa
aaacctaaatcggttgaacgcattgtttttgcatcaggtaaattggcggttgaacttcgt
gaaaaagcggcaactgaacaaaaaacggactggttgcaaatcatcagtatcgaagaaatt
tatccattcccgttcactggcgttcaagaagctttgaaaaaatatacaaatcttaaagag
atcttctgggctcaagaagaacctaagaacatgggggcttggacatttgttgaacctcgc
cttaatgcagcggctcctggaaacctttcagtgacatatataggaaggaagcgcagatca
agcccggctgagggagatccgcttgtccataaaaatgaacaacaacggattatgactcaa
gcaattacacgcaataatgagggggagaaataa

DBGET integrated database retrieval system