KEGG   Bacillus simplex: UP17_18195Help
Entry
UP17_18195        CDS       T04304                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bsj  Bacillus simplex
Pathway
bsj00010  Glycolysis / Gluconeogenesis
bsj00030  Pentose phosphate pathway
bsj00051  Fructose and mannose metabolism
bsj00052  Galactose metabolism
bsj00680  Methane metabolism
bsj01100  Metabolic pathways
bsj01110  Biosynthesis of secondary metabolites
bsj01120  Microbial metabolism in diverse environments
bsj01130  Biosynthesis of antibiotics
bsj01200  Carbon metabolism
bsj01230  Biosynthesis of amino acids
bsj03018  RNA degradation
Module
bsj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bsj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UP17_18195
   00030 Pentose phosphate pathway
    UP17_18195
   00051 Fructose and mannose metabolism
    UP17_18195
   00052 Galactose metabolism
    UP17_18195
  09102 Energy metabolism
   00680 Methane metabolism
    UP17_18195
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    UP17_18195
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bsj01009]
    UP17_18195
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bsj03019]
    UP17_18195
Enzymes [BR:bsj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     UP17_18195
Protein phosphatases and associated proteins [BR:bsj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     UP17_18195
Messenger RNA biogenesis [BR:bsj03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     UP17_18195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AMM94176
UniProt: A0A127DAW4
LinkDB All DBs
Position
complement(3904487..3905446)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIFHEMEVFGIYYGYQGLINGNIRKLELGSVGDI
IHRGGTMLHTARCPEFKTEEGQLKAIEQLNKLGIEGIVIIGGDGSYRGAKALTERGFPCI
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVVEVMGRNAGDIALWA
GLAGGAETILCPECEYDMEDLIGKLNRGHDRGKKHSIIIVAEGVGSAVDISRKIEAKAGF
ETRVTVLGHVQRGGSPSANDRVLASRLGAKAVELLLEGKGGRAVGIEQNRLVDYDIIEAL
AKPHTIDKKMYDLSSELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaattggtgtattgactagtggaggagattctccaggcatgaatgcggcagtc
cgggcggttgtccgtaaagcaatttttcatgaaatggaggtcttcgggatttattatgga
tatcagggccttataaatgggaatataaggaaacttgagcttgggtcggtcggggatatc
attcatcgaggcggcacaatgttacatacggctcgctgtccggaatttaagacagaggaa
ggccagctgaaagcgattgaacaactgaataaacttggcatcgagggcattgtcataata
ggtggcgatggttcttaccgtggagcgaaagctttgactgaaaggggcttcccttgtatc
ggagttcctggaacgattgataatgacataccgggtactgactttacgattggtttcgat
acagccctgaatacagtaatcgacgcaatcgataagattcgggatacggcaacttctcat
gaaaggacctatgtggtcgaagtaatgggaagaaatgccggcgatatcgcgctttgggcc
ggcctggctggcggagcggaaacgatcctttgtcctgaatgcgaatatgatatggaagat
ctgattgggaagctgaaccgcggacatgaccgtgggaaaaagcatagtatcatcattgta
gctgaaggtgttggaagtgccgttgatatttcgaggaaaattgaggcgaaagcaggattt
gaaacccgtgtaacggttctcggccatgtccagcgcggaggatctccttcggcaaatgac
cgtgtattggcaagccggcttggagccaaagctgttgaattgcttcttgaaggcaaaggg
ggcagggctgttggaatagaacaaaatcggctagttgattatgatatcatcgaagccctt
gctaaaccgcatacaattgacaagaaaatgtatgatttatcctctgagttatccatttaa

DBGET integrated database retrieval system