KEGG   Bacillus simplex: UP17_19520Help
Entry
UP17_19520        CDS       T04304                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
bsj  Bacillus simplex
Pathway
bsj00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bsj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    UP17_19520
Enzymes [BR:bsj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     UP17_19520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh P-II Adaptin_binding OmdA
Motif
Other DBs
NCBI-ProteinID: AMM94405
UniProt: A0A127DBB1
LinkDB All DBs
Position
complement(4178303..4179766)
Genome map
AA seq 487 aa AA seqDB search
MITTVQTKTYLNYINGEWVASISKEVEKSLNPADKQAIVGYVQKSNVDDLNRAVEAAKKA
KDKWRKLAGSERGEYLYKVAHILEKRIDEIAECATREMGKTFAETKGETARGIAILKYYA
GEGMRKVGDVIPSTESSALMFTTRVPLGVVGVITPWNFPIAIPIWKMAPALVYGNTIVVK
PATETAITCAKIMECFEEAGLPEGVINMVTGPGSVIGQGIADHEDVNGITFTGSNGVGKR
IGQAALARGAKYQLEMGGKNPVIVAADADLNLAVEAVITGAFRSTGQKCTATSRVIVAAE
VYEEFKQLLVKETKGISIGDGLDSGTWMGPCASENQLKTVLSYIEKGVEEGATLLTGGKR
AEEGTQANGFYVEPTIFDNCTSDMAIVQEEIFGPVIALLKAESVEEALQLANSVEYGLSA
SIFTANIQHLLSFVNDMEAGLIRVNAESAGVELQAPFGGMKNSSSHSREQGEAAKEFFTS
IKTVFVK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgataactacagttcaaacaaaaacgtatcttaactatattaacggtgaatgggttgct
tccatttcaaaagaagttgaaaaaagtttaaacccagccgataaacaggccattgtcgga
tatgtacaaaaatctaacgtggatgacttgaatcgtgcagtagaagctgcgaaaaaggcg
aaagacaaatggcgcaaactagcaggatcagagcgcggggagtatctatataaagtagcc
catattcttgaaaagcggattgatgaaatcgcagaatgtgcaacacgtgaaatgggtaag
acttttgcagaaacaaaaggggaaacggcacgcggtattgcgatcctgaaatactatgca
ggagaaggaatgcgtaaagtgggggatgtcattccatccaccgaaagttcagcgcttatg
ttcacgacgcgcgtcccgcttggtgtagtgggcgtcattacaccttggaatttcccaatc
gccatcccgatctggaagatggctcctgctctcgtttatgggaatacgattgtggtgaag
ccagccacagagacggccatcacctgtgcgaagatcatggagtgttttgaagaagctggt
ttaccggagggtgttatcaatatggtcacagggccgggcagtgtcatcgggcagggcatc
gccgatcacgaagatgtaaacggaattacctttaccggctcaaacggcgttggaaaaagg
attggacaagcggcgttagcacgaggagcgaaataccagcttgaaatgggcgggaaaaac
ccggtaatcgttgcagcggatgcggatcttaatctggctgtagaagcagtcattacaggc
gcgtttcgttcgacggggcaaaaatgtaccgcgacaagccgtgtcatcgttgcagctgaa
gtttatgaagagttcaagcagttgctggtgaaagaaacgaaaggcatttccatcggggat
ggattggacagcgggacttggatgggaccatgcgctagcgaaaatcaattaaaaacggtt
ctttcctatatcgaaaaaggagtcgaggaaggcgctacacttctaactggcggaaagcgt
gctgaagaaggcactcaggctaatggcttttatgtagagcctacgatctttgataactgc
acgtcagatatggcaatcgtacaggaagaaatttttggtccggtgattgctttattgaaa
gctgaatcagtcgaagaagccctgcaacttgcgaacagcgtcgaatacggcctgagtgct
tcgatttttactgccaatatccaacatttgctttcgtttgttaacgatatggaagccgga
ttgatcagggtcaacgctgagagcgcaggcgttgaattgcaggcgccatttggcggcatg
aaaaactccagctcccactccagggaacaaggagaagcagcaaaagagttttttacatcc
attaaaacggtgtttgtaaaataa

DBGET integrated database retrieval system