KEGG   Bacillus simplex: UP17_22480Help
Entry
UP17_22480        CDS       T04304                                 

Definition
(GenBank) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
bsj  Bacillus simplex
Brite
KEGG Orthology (KO) [BR:bsj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsj01002]
    UP17_22480
Enzymes [BR:bsj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     UP17_22480
Peptidases [BR:bsj01002]
 Metallo Peptidases
  Family M4: thermolysin family
   UP17_22480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: AMM94871
UniProt: A0A127DCP6
LinkDB All DBs
Position
4795892..4797517
Genome map
AA seq 541 aa AA seqDB search
MKGKVFVGTALSIGLLFSAIPHQEALAAKNVLSVEKYNKHRDSLEYKSGKLTEPSKQTAE
DIILTFFDENKKSYKLEKQKAKDSFTIEKESKDELGNTVLKLQQTYKGVPVWNSTQAVLI
DAKGVLTVVSGTVEANLNTKLGKKAKKGISESEAIKIAEADLGFTPAYEQSPESELYVYA
NEGKADYVYKVNLKFLSPEPGNHNYFISVKTGKILNKYNTLDEVTGTNSVGTGTGVLNNT
VSLNTTLSNGQYYLQDNTRGKGIFTYNANNRSKLPGTLFSNTTNAFTTSTDKAAVDAHFY
AGNTYDYYKSTFGRNSYDGNGTILKSTVHYGSRYNNAFWDGTQMVYGDGDGTTFIPLSGG
LDVVAHELTHAVTSSESNLTYQYESGALNEAISDIFGTVVEFKNQSAKADYLIGEDIYTP
NISGDALRSMANPTLNGDPDHYSNRYTGTGDNGGVHTNSGIINKAAYLISAGGTHHGVSV
SGIGIDKLGTIFYRANTTYLTSSSTFSQARAAVIQAASDLYGSSSAEVTAVKNAFTAVGV
I
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtaaggtatttgtaggaactgcactatccatcggtctattattttctgctatt
ccccatcaagaagctttagcggcaaaaaatgtgttaagtgttgaaaagtacaataagcat
agggattcgctagaatacaagtctgggaagcttacggaaccctcaaagcaaacggcagaa
gatatcattcttaccttttttgatgagaacaaaaagtcttacaagctagaaaagcaaaag
gcgaaggactccttcacgatcgagaaagaaagcaaggatgaactgggcaatactgtcctt
aaattgcaacaaacctataaaggcgtaccagtatggaattccacacaagccgtattgatt
gacgctaaaggtgtattgaccgtcgtgtccggtacggttgaagccaatctaaacacgaaa
ttagggaaaaaggctaaaaaaggcatcagtgaatctgaagctatcaaaatagcggaagcg
gatctggggttcacacctgcctacgagcaatcacctgaatctgagctatatgtatacgca
aatgaaggcaaggccgattatgtatataaagtcaatttgaaattcttaagtccggaacct
ggaaatcataattatttcatttcagtcaaaacgggtaaaatcctgaataaatacaataca
ctagatgaagtgacgggaaccaattccgtcggaacgggcactggcgtcttaaacaacacc
gtatcgttgaacactaccttatccaacggtcaatactatttacaagacaatacacgcggc
aaaggcattttcacctataatgccaataaccgttcaaaattgcctggtacactcttttcc
aacacaacaaatgcttttactacttctaccgataaagctgcggtggatgcccatttttat
gcaggtaacacctatgattattacaaatccacatttggacggaattcttatgatggaaat
ggaaccatcctgaaatcaaccgttcattatggctcgagatacaataatgctttctgggat
ggcacccaaatggtttacggtgatggagatggcacgacgttcatcccattgtccggcggg
ctcgatgtcgttgcgcatgaattgacgcatgccgtcacttcctcggaatcgaaccttacc
tatcaatatgaatccggtgctttgaatgaagcgatatctgatatttttggcacggtcgta
gaatttaagaatcaaagtgccaaagcggattatttgatcggagaagatatttacacacct
aacatttccggtgatgcactccgctcgatggctaatccaacattgaatggggaccctgac
cattattcgaaccgttatacaggaacgggtgataatggcggagtccacacgaacagcgga
atcattaataaggcagcttatttaatctctgcaggcggaacccaccatggcgtgagtgta
tccggaatcggcatcgataaactgggaaccatcttttatcgggcaaacacaacatattta
acttcgtcgtctactttttcacaagccagagcggccgtcatacaagcggcctctgattta
tacggttctagcagtgcagaagtcacagctgtcaaaaatgcctttacagctgtcggtgtg
atttaa

DBGET integrated database retrieval system