KEGG   Bacillus simplex: UP17_23525Help
Entry
UP17_23525        CDS       T04304                                 

Definition
(GenBank) NUDIX hydrolase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
bsj  Bacillus simplex
Brite
KEGG Orthology (KO) [BR:bsj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsj03400]
    UP17_23525
Enzymes [BR:bsj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     UP17_23525
DNA repair and recombination proteins [BR:bsj03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    UP17_23525
 Prokaryotic type
    UP17_23525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4
Motif
Other DBs
NCBI-ProteinID: AMM95055
UniProt: A0A127DD65
LinkDB All DBs
Position
complement(5008471..5008929)
Genome map
AA seq 152 aa AA seqDB search
MQRVTNCVLIKDDQILLLKKPRRGWWVAPGGKMEPGESVRDACIREYREETGVYLKNPSI
KGIFTFIMKDGDKVLSEWMMFTFFATDSDGVNVDVCEEGELSWHPVDDVKKLKMAEGDFH
ILDYMVHGSGIIYGTFTYTPEFKLLSYRLDPG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacgtgtcacaaactgtgtattgattaaggatgatcaaatcctcttattgaaaaaa
cctagacgcggatggtgggtagctccaggcggcaagatggagcctggggaatctgtacgt
gatgcttgtattagagaatatcgcgaagaaacaggagtttatttgaaaaacccttccata
aaaggtattttcaccttcattatgaaggacggggataaagttttgtcagagtggatgatg
ttcactttctttgcgacggattcagatggtgtcaatgtggatgtttgtgaagaaggggaa
cttagctggcatccggttgatgatgttaaaaagctgaaaatggctgagggtgattttcat
attctggactatatggtccatggaagtggaatcatttatggaacgtttacctatacgcct
gagtttaagttactttcttatcgattggatccaggttaa

DBGET integrated database retrieval system