KEGG   Bacillus simplex: UP17_23540Help
Entry
UP17_23540        CDS       T04304                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
bsj  Bacillus simplex
Pathway
bsj00340  Histidine metabolism
bsj01100  Metabolic pathways
bsj01110  Biosynthesis of secondary metabolites
bsj01230  Biosynthesis of amino acids
Module
bsj_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bsj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    UP17_23540
Enzymes [BR:bsj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     UP17_23540
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     UP17_23540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG SH3_9 SH3_1
Motif
Other DBs
NCBI-ProteinID: AMM95058
UniProt: A0A127DDH1
LinkDB All DBs
Position
complement(5012577..5013230)
Genome map
AA seq 217 aa AA seqDB search
MNLETIKYDDKGLIPAIIQDAGTGEVLTLAYMNEESLKLSIEKGETIFFSRSRNELWHKG
ATSGNKQKIIEMKYDCDQDALVVRVVPAGPACHTGTTSCFSESIYQNNEAGQAMQANVTF
LTELETLIKKRKSEMPEGSYTTYLFEKGVDKILKKVGEEAAEVIIAAKNRDAEELSMESA
DLLYHLFVLLQEQELPFQAVLDVLKARHSDKDEPKET
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttgaaactattaaatacgacgataaaggtctaataccggcaatcattcaagat
gccggaaccggtgaagtgctgacacttgcttacatgaatgaagaatctctaaaattgtcc
atcgaaaaaggcgaaacgattttcttcagccgttcacgcaatgaattatggcataaagga
gcaaccagcggtaataaacagaaaatcatcgaaatgaagtatgattgcgatcaggatgca
ttggtggttcgagtcgttcctgcaggtccagcgtgccatacagggacaacaagctgtttt
agcgaatcgatttaccaaaacaatgaagctggacaagccatgcaggcgaatgtgactttc
ttgacggaattggaaacattgattaaaaaaagaaaatcggaaatgcctgaaggttcatat
acaacttacttattcgaaaaaggcgttgataaaatcctgaaaaaagtcggtgaagaagcc
gcggaagtcatcattgctgccaaaaatcgcgatgcagaggaactttccatggaaagtgcc
gatctcctttatcacttattcgttcttcttcaggaacaagaattgcctttccaagcggtg
cttgatgtattaaaggctagacattccgataaggacgaaccaaaagaaacctaa

DBGET integrated database retrieval system