KEGG   Bacillus simplex: UP17_24840Help
Entry
UP17_24840        CDS       T04304                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bsj  Bacillus simplex
Pathway
bsj00500  Starch and sucrose metabolism
bsj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UP17_24840
Enzymes [BR:bsj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     UP17_24840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: AMM95278
UniProt: A0A127DE43
LinkDB All DBs
Position
5298155..5299636
Genome map
AA seq 493 aa AA seqDB search
MKRNHTMMQFFEWHLEADGSHWDRLKYAASKLKDIGIDCVWLPPVTKGQSVGDNGYGIYD
GYDLGEFDQKGTVRTKYGTKDELLQAIATCHNYGLCVYIDLVMNHKAGADGTEKFEVIEV
NPDNRMEDISEPFEMEGWTKFDFPGRKNKYSDFKWNHTHFNGTDYDAENDKMGVFRITGE
NKHWNPHVIDEFGNYDYLMFANIDYSLPEVRQEMISWGKWMVDTLKCDGFRLDAVKHIDY
EFINEFLKELIPYTKEHFFMVGEFWKADVKACQTYLEHTNHDLNLFDVSLHYKFHEASKA
GADFDLSTIFDDTLVQTNPAQAVTFVDNHDSQPHESLESWVKDWFKPSAYALILLRLCGY
PCVFYGDYYGIGGPSPVPGKKDILDRLLYARYEKAYGEQTDYFDDQNTIGWVRLGVKELE
GSGCAVIISNGDHNSEKRMFVGEHRAGETWSDLTYHRDDHIIIEADGFATFPVHGKSVSV
WALNDVPLKTTPL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaatcatacgatgatgcaattttttgagtggcatcttgaggcggatggttct
cattgggacagattgaaatacgcagcctctaagttgaaggatataggaattgattgcgtt
tggcttccgccagttaccaaagggcaatccgttggggataatggatatggaatatatgac
ggttacgatttgggggaatttgaccaaaaaggaaccgttcgtaccaaatacgggaccaaa
gatgaattgctgcaagcaatagccacttgccataactacggactttgcgtttatatcgat
ttagtcatgaaccataaagcaggagctgatggaaccgaaaaatttgaagtgattgaagtc
aatccagacaaccggatggaagatatctcagaaccgtttgaaatggaaggctggacaaaa
ttcgatttcccgggccgtaaaaataaatactctgactttaagtggaaccatactcatttt
aacggtacagactatgatgccgaaaacgacaaaatgggtgtatttcgaatcacaggcgaa
aataagcactggaatccgcatgtcatcgatgaattcggaaactatgattatttaatgttt
gccaacatcgattacagcctgccggaagttcgtcaggaaatgattagctggggaaaatgg
atggttgatacgttaaagtgtgatggttttcgtttggacgccgttaagcatatcgattat
gaattcatcaatgagttccttaaagaactcattccttatacaaaggaacatttcttcatg
gtcggcgaattttggaaggcggatgttaaagcttgtcaaacatacttagagcacaccaat
catgacctcaacttgttcgatgtttccctgcattataaatttcacgaggcttcaaaagca
ggagcagacttcgacctctcaaccatctttgatgataccctcgtccaaaccaatccggca
caggccgtcacttttgtcgacaaccacgactcccagcctcatgaatcactggagtcttgg
gtaaaggactggtttaaaccatcggcatatgcacttatcttacttagactttgcggttat
ccctgtgtcttttacggggactattatggaatcggcgggccttctccggtacctggaaaa
aaggatattctagatcgtctcttatatgctaggtatgaaaaagcttatggagaacagacg
gactattttgacgatcaaaatacgataggctgggtccggctcggggttaaagagctagaa
ggctcggggtgtgccgtcattatctcaaatggagatcacaacagtgaaaaaaggatgttc
gtcggtgaacatcgagctggtgaaacctggagtgatttaacctatcatagagatgaccac
attatcattgaagcagatggtttcgcgacctttcccgttcatgggaaaagcgtatccgta
tgggcattaaatgatgtaccacttaaaacgacaccactctaa

DBGET integrated database retrieval system