KEGG   Bacillus simplex: UP17_25455Help
Entry
UP17_25455        CDS       T04304                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bsj  Bacillus simplex
Brite
KEGG Orthology (KO) [BR:bsj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    UP17_25455
Enzymes [BR:bsj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     UP17_25455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 Thioredoxin_3 GIDA HI0933_like DAO FAD_oxidored FAD_binding_3 Thi4 AlaDh_PNT_C Glutaredoxin NAD_binding_8 NAD_binding_7 K_oxygenase Thioredoxin_4 FMO-like
Motif
Other DBs
NCBI-ProteinID: AMM95780
UniProt: A0A127DFI0
LinkDB All DBs
Position
pSHB26:complement(82920..84449)
Genome map
AA seq 509 aa AA seqDB search
MVLDADIKAQLAQYLQLIEGDILLKVSAGSDDTSKDMLGLVDELATMSSKIKVEKTELER
TPSFSVNRVGEDTGVTFAGIPLGHEFNSLVLALLQVSGRAPKVEEKVIDQIKSIQGEYRF
ESYISLSCHNCPDVVQALNLMSVLNLDITHTMIDGASFKEEVENKGIMAVPTVYLNGESF
GSGRITLEEILAKLGSSPDASEFMDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTMGIENFISVKHTEGPKLVASLEEHAKDYDIDVMNLQRAKRLEKKDLIEVELE
NGAVLKSKSVIVATGARWRNVGVPGEDEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFMPELKADDVLQKRLYSLPNVTVLRNVQTKEITGTDQVEGISY
IDRETGEVHHIELQGVFVQIGLVPNTDWLGDTVERTPFGEIVTDKHGSTNVPGVFAAGDC
TNNPYKQIIISMGSGANASLGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtactagatgcagatatcaaagcacaattagcccaatatcttcaactgattgaaggc
gatatactacttaaagttagtgcaggatctgatgacacatctaaagacatgctaggtcta
gtagatgaattagcaactatgtcatcaaaaatcaaagtagaaaaaacagaattagaaaga
actccaagctttagtgtaaatcgtgtcggtgaagatactggagtaacatttgcaggtatc
cccctaggacacgaatttaattcactagtattagctttactacaagttagtggaagagct
ccaaaagttgaggaaaaagtaattgatcaaattaaaagcattcaaggtgaatatcgcttt
gaatcttatatcagcctaagctgtcataactgtccagatgttgtgcaagcactgaattta
atgagcgttcttaaccttgatattacacatacgatgattgatggcgcttcattcaaagaa
gaagtagaaaacaaaggcatcatggcagtaccaactgtttacttaaatggtgaatcattc
ggaagtggtcgtattacacttgaagaaatccttgcgaaactgggtagcagtccagatgca
tcagaattcatggataaagatccatacgatgttcttgttgttggtggcggtccagctggt
gcaagtgcggcaatttacgcagcacgtaagggtattcgcacaggtattgttgctgagcgc
tttggtggccaagtaatggatacaatgggtatcgagaacttcatcagtgtaaaacacact
gaaggtcctaagcttgtagcaagccttgaagaacacgcaaaagattacgacatcgacgta
atgaacttacaacgtgcgaagcgtttagaaaagaaagacttaatcgaagtagagcttgaa
aacggtgcggttctaaagagtaagagtgtaatcgttgcaacaggtgctcgttggcgtaat
gttggtgtaccaggtgaagatgaattcaaaaataaaggtgtagcatactgcccacactgt
gatggtcctttattcgaaggaaaagacgtagcagttatcggcggtggtaactctggtatt
gaagcagcaattgacttagcaggtatcgtaaaacacgtaactgttcttgagttcatgcca
gaactaaaagctgatgatgtattacaaaaacgtctttacagtttacctaacgtaactgta
ttaaggaacgttcaaacaaaagaaattactggaactgaccaagtagaaggtatttcttac
atcgatcgtgaaactggagaagttcatcacatcgaattacaaggtgtattcgttcaaatc
ggtcttgtaccaaatacagattggctaggcgacaccgttgaacgcactccatttggtgaa
atcgttacagataagcacggttctacaaacgtacctggcgtatttgctgcaggcgactgt
acaaataacccatacaaacaaatcattatttcaatgggatcaggagcaaacgcatctctt
ggcgcatttgattacctaatccgaaattaa

DBGET integrated database retrieval system