KEGG   Brucella canis HSK A52141: BCA52141_I2896Help
Entry
BCA52141_I2896    CDS       T01705                                 

Definition
(GenBank) D-alanine-D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bsk  Brucella canis HSK A52141
Pathway
bsk00473  D-Alanine metabolism
bsk00550  Peptidoglycan biosynthesis
bsk01100  Metabolic pathways
bsk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BCA52141_I2896
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BCA52141_I2896
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BCA52141_I2896
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsk01011]
    BCA52141_I2896
Enzymes [BR:bsk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BCA52141_I2896
Peptidoglycan biosynthesis and degradation proteins [BR:bsk01011]
 Precursor biosynthesis
  Amino acid ligase
   BCA52141_I2896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AEW14821
LinkDB All DBs
Position
1:1776048..1776974
Genome map
AA seq 308 aa AA seqDB search
MTGKHVAVLMGGFSSERSVSLSSGVACATTLEECGYRVTRIDVDRNVASILVELKPDVVF
NALHGPFGEDGAIQGVLEYLQIPYTHSGVLASALAMDKDRAKKVAAAAGVVVAPSRLMNR
FDIGSQHPMKPPYVVKPVREGSSFGVVIVKEDQPHPPQVIGSADWKYGDEVMVEGYIAGR
ELTCAVMGDRAMDVCEIIPVGYQFYDYDSKYVAGASTHVSPAKILPNIYQKIQTMALTAH
RAIGCRGVSRSDFRFDDRFSEEGEVVWLEINAQPGMTPTSLVPDIAKAAGISFAELLSWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaaaacacgtcgccgttttgatgggtggtttttcttcggaacgctccgtcagc
ctttcctccggtgtggcctgtgcaacgacgcttgaagaatgcggctatcgcgtcacgcgc
attgatgtggatcgcaatgttgcgagcatcctggtcgagttgaaacccgatgttgtgttc
aacgccttgcacggccccttcggcgaagatggcgccattcagggcgtgcttgaatatctc
cagattccctacacacattccggcgtgctggcttccgcgcttgcgatggacaaggatcgc
gccaagaaggtggcggcagcggcgggcgtcgtggttgcgccgtcacgcctgatgaaccgt
ttcgacattggttcgcagcatccgatgaagccgccttacgtggtgaagccggtgcgtgaa
gggtcgagcttcggtgtggtgatcgtcaaggaagatcagccgcatccgccgcaggtcatc
ggttcggccgattggaaatatggtgatgaggtcatggtcgaaggctatattgccgggcgt
gagctgacctgtgccgtgatgggggatcgcgccatggatgtgtgcgagatcattccggtc
ggttatcagttctacgactatgattcaaaatatgttgcaggtgcatcaactcacgtgtcc
ccggcaaaaattttaccaaatatttaccaaaaaatacaaacaatggcccttacggcgcat
cgggcaatcgggtgtcggggcgtaagccggtcggacttccgtttcgatgatcgtttttct
gaagaaggcgaagttgtctggctggaaatcaatgcccagccggggatgactcctacctcg
ctcgtgcctgatatcgccaaagcggcgggtatctctttcgctgagttgttgagttggatg
gtggaggacgcgtcttgtttgcgttga

DBGET integrated database retrieval system