KEGG   Brucella canis HSK A52141: BCA52141_I2940Help
Entry
BCA52141_I2940    CDS       T01705                                 

Definition
(GenBank) drug resistance transporter Bcr/CflA subfamily
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
bsk  Brucella canis HSK A52141
Brite
KEGG Orthology (KO) [BR:bsk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsk02000]
    BCA52141_I2940
Transporters [BR:bsk02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    BCA52141_I2940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: AEW14848
LinkDB All DBs
Position
1:1805469..1806680
Genome map
AA seq 403 aa AA seqDB search
MASSLVRNAIVLGLLSAIGPFAIDMYLPALPTIATDLRAETGAVQMSLLAFFLALALAQL
FCGPLSDMVGRKLPLYGGLVLFAIGSIGSALAANIDVLVLFRFVQGLGAAAGMVIPRAIV
RDLHMGVEAARLMSLLMLVFSISPILAPLTGSIIISFFGWRGVFWAVLLAAGIGIILVAT
AQKETRSVEARLESNISSALRGYGRLLKDRHFLGLVFVGGFGLASLFVYLANSAFVLIDH
YGLTPIQYAVAFSVNAVSFFGVSQLNGWLGARFGLGRVMRFAACGFAAAMLAMFAAALMG
HQSLWLVASFLFVGYGFLGLVIPATAVLALEEHGEIAGTASALMGTLHFVIGGVAIGIVG
AYSDGTALSMIGGITGCALAAFVLAQIVLARKSRKRGRATAAA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggcttccagtcttgtgcgcaatgccattgttcttggccttctttcggccatcggtcct
tttgcgattgatatgtatctaccggccctgccgaccattgccaccgatctgcgggcggaa
accggcgcggtgcagatgagcctgctcgccttctttctggcactggcgctggcgcagctt
ttctgcgggcccctgtccgatatggtcgggcgtaaactgccgctttatggcgggctggtg
ctcttcgccataggcagcatcggttcggcgcttgcggccaatatcgacgtgctggtgctg
ttccgtttcgtccagggattgggggctgcggcaggcatggtgataccgcgcgccatcgtg
cgcgatcttcatatgggtgtcgaggccgcgcgccttatgtcgcttttgatgctggtcttt
tcgatttcgccgattctggccccgctgactggctccatcatcataagctttttcggctgg
cgcggggttttctgggccgtgttgcttgccgccggcatcggcatcatactggttgcgacc
gcgcagaaggaaacgcgcagcgtcgaggcgcggcttgagagcaatatcagcagcgcattg
cgcggttacgggcggctgttgaaggaccgtcatttcctcggcctcgtcttcgtgggcggt
ttcggtcttgcgtccttgttcgtttatctggcgaattccgccttcgtgctgatcgaccat
tatggcctgacaccgatacaatatgccgtggcattttccgtcaatgccgtgtcgttcttc
ggcgtttcgcagctcaacggctggcttggcgcgcgtttcggccttggccgggtgatgcgc
tttgctgcttgcggctttgccgcagcaatgcttgccatgttcgcggcggcgctgatgggg
catcaatcactctggctggtcgcaagcttcctctttgtcggttacggcttccttgggctg
gttattccagctacggcggtgctggcgctcgaagaacacggcgagattgccggaacggca
tctgcattgatgggcacgcttcacttcgtcattggtggcgtggcgattggtattgtcgga
gcctattccgatggcacggcgctgtcgatgattggcggcatcaccggctgtgcgctggcg
gcgttcgtgctggcgcagatcgtccttgcccgcaagtcgagaaagcgcggcagagcaacg
gcggcagcctga

DBGET integrated database retrieval system