KEGG   Brucella canis HSK A52141: BCA52141_I3258Help
Entry
BCA52141_I3258    CDS       T01705                                 

Definition
(GenBank) alkaline phosphatase precursor
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bsk  Brucella canis HSK A52141
Pathway
bsk00730  Thiamine metabolism
bsk00790  Folate biosynthesis
bsk01100  Metabolic pathways
bsk02020  Two-component system
Module
bsk_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BCA52141_I3258
   00790 Folate biosynthesis
    BCA52141_I3258
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCA52141_I3258
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsk04147]
    BCA52141_I3258
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bsk00537]
    BCA52141_I3258
Enzymes [BR:bsk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BCA52141_I3258
Exosome [BR:bsk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCA52141_I3258
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bsk00537]
 Enzymes
  BCA52141_I3258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase DUF5300
Motif
Other DBs
NCBI-ProteinID: AEW15052
LinkDB All DBs
Position
1:complement(1984516..1985883)
Genome map
AA seq 455 aa AA seqDB search
MAQSETAAPLFQRSAKGDLSAAGGARRLDGDITAAFRDQIRKGPARNVILLIGDGMGDSE
ITVARNYAVGAGNHFKGIDALPVTGQYTHYSLDKESGKPNYVTDSAASGTAWATGVKTYN
GAIGVDIHGKPHKTLIELAKEKGLGTGNVSTAELQDATPAVQVAHVTHRKCYDPTSTAEK
CKDNALENGGPGSISEQLLNTRPDVTLGGGAKYFEDKARAGTWKGQTLSAQAEARGYQLV
RNADALSKVETANQDKPVLGLFSPGNMPVRWKGPQAAHHGNLDREPVKCKVNEKRTADIP
TLAQMTEKAIDLLKTNEKGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQAALDFAR
KDGNTLVIVTADHAHASQIIDPDAKAPGLSQALKTEDGAIMGVTYGNSDEADDQGHTGAQ
LRIAAFGPGAANFTGLTDQTDMFYTIRDALQLQAE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtctgaaactgcggctccactcttccagcgcagcgcaaaaggcgacctgtcg
gcagcaggcggcgcacgccgccttgatggtgatattaccgcagcttttcgcgatcagatc
aggaaggggcctgccagaaacgtcatcctgctgatcggagacggcatgggcgattccgag
atcacggttgcgcgcaattatgcagtcggcgcaggcaatcatttcaagggcatcgatgcc
cttcccgttaccggccagtacacccattattcgctcgacaaggaaagcggcaagccgaat
tacgtgactgattctgccgcctccggcaccgcctgggccactggcgtcaaaacctataac
ggcgccatcggcgtcgatattcatggcaaaccgcacaaaacgctcattgaactcgccaag
gaaaagggcctcggcaccggcaatgtcagcactgccgaattgcaggatgccacacccgcc
gtgcaggttgcccatgttacccatcgcaagtgctacgacccaaccagcacggcggaaaag
tgcaaggataatgcgcttgaaaatggcggcccaggctcgatcagcgaacagcttttgaac
acccgcccggacgtgacattgggcggcggcgcaaaatatttcgaggacaaggcccgggct
ggcacatggaaaggccagaccttgagcgcacaggccgaagcacgcggctatcaactggtt
agaaatgccgacgcattgagcaaggtcgagacagccaatcaggacaaacctgttctcggc
ctcttctcaccgggcaacatgccggtccgctggaaagggcctcaggccgcccatcacggc
aatctcgacagagagcctgtcaagtgcaaggtcaatgagaagcgcactgccgatattccg
acactggcgcaaatgaccgagaaagccatcgacctgctgaaaaccaacgaaaaaggcttt
ttccttcaggtggaaggtgcctccatcgacaaacaggaccatgccgccaatccgtgcggg
cagatcggcgaaacagtcgatctggatgaagccgtgcaggccgcactcgattttgcccgc
aaagacggcaacacgcttgtcatcgtaacggccgatcacgcccatgcaagccagatcatt
gatcccgatgcgaaggctccgggtttgagccaggcattgaaaaccgaggatggcgcgatc
atgggcgtgacctatggcaattccgacgaagccgacgatcagggccacacaggcgcgcaa
ttgcgcatagccgcctttggccccggcgctgccaattttaccggcctcacggatcagacg
gatatgttctacacgatccgcgatgccttgcagttgcaggcggaataa

DBGET integrated database retrieval system