KEGG   Brucella canis HSK A52141: BCA52141_II0261Help
Entry
BCA52141_II0261   CDS       T01705                                 

Definition
(GenBank) Carboxymuconolactone decarboxylase
  KO
K01607  4-carboxymuconolactone decarboxylase [EC:4.1.1.44]
Organism
bsk  Brucella canis HSK A52141
Pathway
bsk00362  Benzoate degradation
bsk01100  Metabolic pathways
bsk01120  Microbial metabolism in diverse environments
bsk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCA52141_II0261
Enzymes [BR:bsk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.44  4-carboxymuconolactone decarboxylase
     BCA52141_II0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMD
Motif
Other DBs
NCBI-ProteinID: AEW15327
LinkDB All DBs
Position
2:complement(169713..170129)
Genome map
AA seq 138 aa AA seqDB search
MAENATETAPSERYKLGMRVRRSVLGDTHVDRASNGATELDAPFQALITEAAWGTVWARP
GWSKRERSIVTIALLAALGQDDEVAMHIRATRNTGATKEDICEALMHVAIYAGVPASNHA
FKIAKQTYAQMEAEEAEK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaacgccaccgagaccgcgccgtccgagcgttacaagcttggcatgcgcgtg
cgccgctccgttctgggcgatacgcatgtggatcgcgcatcaaacggcgcgaccgagctt
gatgcaccgtttcaggcgcttataaccgaagcggcatggggcacggtttgggcgcgtccg
ggttggagcaagcgtgagcggtctatcgtcaccatcgcactgctggcagcattgggacag
gatgacgaagttgccatgcatattcgcgccacgcgaaacacgggcgcaacgaaggaggac
atctgcgaagcgttgatgcatgtcgcgatctatgcgggggttccggcgtcgaaccacgct
ttcaagatcgccaagcagacctatgcgcagatggaagcggaggaagctgaaaaatga

DBGET integrated database retrieval system