KEGG   Brucella canis HSK A52141: BCA52141_II1715Help
Entry
BCA52141_II1715   CDS       T01705                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bsk  Brucella canis HSK A52141
Pathway
bsk00473  D-Alanine metabolism
bsk01100  Metabolic pathways
bsk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BCA52141_II1715
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BCA52141_II1715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsk01011]
    BCA52141_II1715
Enzymes [BR:bsk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BCA52141_II1715
Peptidoglycan biosynthesis and degradation proteins [BR:bsk01011]
 Precursor biosynthesis
  Racemase
   BCA52141_II1715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEW16240
LinkDB All DBs
Position
2:complement(1093426..1094625)
Genome map
AA seq 399 aa AA seqDB search
MVEMSLPFSQDERDLAAGGILTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRV
APAFYEAGCRDFFVAHLGEAVALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLE
QVENWAALATRLGKKLPALLQFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLAN
GDEPGNAANARQLAKMTALLARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPER
QHDFSDKVAHENKKPKHSILPVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAV
GYADGLFRSLSNKGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQR
LEDVARDCDTIPYEILTALGNRYARVYVYVNGGGTSTTA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggttgagatgtctttacctttttctcaggatgagcgcgatctcgcggctggcggcata
ttgaccattgatctcgcagccctgcgccacaattattcagccatcgcaacccgcattgcc
ccaacccgtacggccgctgtggtaaaggcagacgcctatggcctgggcgcaagccgggtc
gcaccggctttctacgaggccggttgccgcgatttcttcgttgcacatcttggcgaagca
gtggcgctgaagccctttttgaaacctgacgcaacactttatgtcctgaacggccttcag
cccggaacggaagcagcctgtgcccgcgaaggcatcctgcctgttctcaattcgctggaa
caggttgaaaactgggcagcactcgccacccggctgggcaaaaaactgcccgccctgctc
cagttcgataccggcatgtctcgtcttggcctgtcagccaaggaatttgaccgccttctt
gagaacgtcacgctcctgagcaggatcgacatcaaattcgccatcagccatctggcaaac
ggcgacgagccgggaaatgcggcaaatgcccgtcagcttgccaagatgacggccttgctc
gctcgcctgccgaaactgccggctgccttggccaattccggcggcaccttcctcggcaag
acctattatttcgatctcgcccgccccggcatcgcgctatatggcatcgatccggagagg
cagcatgacttttcggataaggtggcgcacgagaataagaaacccaagcattcgatcctt
cccgtcctcaccctttcggcgcgtgtcattcaggtgcgcgacgtcgacaagggagcgaca
gttggctatggcggcacctatgtcgccaacggcccgatgcggattgcgacgattgcggtc
ggctatgctgacggcttgttccgttccttgagtaacaagggcgcagcctttttcggcgat
acgcgcctgcccatcatcgggcgcgtatcgatggattcgatcacgctcgacgtcacctca
ttgccggagggaacgctgaaactcggcagccttgtggaattgatcggcccgcatcagcgc
ctcgaagacgtggcgcgggactgcgacactatcccctatgaaattctgactgcgcttggc
aaccgttatgcgcgcgtttacgtttacgtgaacggcggtggcaccagcacaacagcataa

DBGET integrated database retrieval system