KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_0093Help
Entry
A7A1_0093         CDS       T02384                                 

Definition
(GenBank) Elongation factor Tu (EF-Tu; P-40)
  KO
K02358  elongation factor Tu
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Brite
KEGG Orthology (KO) [BR:bsl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bsl03012]
    A7A1_0093
   03029 Mitochondrial biogenesis [BR:bsl03029]
    A7A1_0093
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsl04147]
    A7A1_0093
Translation factors [BR:bsl03012]
 Eukaryotic Type
  Elongation factors
   A7A1_0093
 Prokaryotic Type
   A7A1_0093
Mitochondrial biogenesis [BR:bsl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    A7A1_0093
Exosome [BR:bsl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   A7A1_0093
  Exosomal proteins of breast cancer cells
   A7A1_0093
  Exosomal proteins of colorectal cancer cells
   A7A1_0093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW DLIC RsgA_GTPase Peptidase_U32_C
Motif
Other DBs
NCBI-ProteinID: AGA20711
LinkDB All DBs
Position
complement(3909821..3911011)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFDRSKSHANIGTIGHVDHGKTTLTAAITTVLHKKSGKGTAMAYDQIDGAPEERER
GITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREH
ILLSKNVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVVKGSALKAL
EGDAEWEAKIFELMDAVDEYIPTPERDTEKPFMMPVEDVFSITGRGTVATGRVERGQVKV
GDEVEIIGLQEENKKTTVTGVEMFRKLLDYAEAGDNIGALLRGVSREEIQRGQVLAKPGT
ITPHSKFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGIIHLPEGVEMVMPGDNTE
MNVELISTIAIEEGTRFSIREGGRTVGSGVVSTITE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaattcgaccgttccaaatcacatgccaatattggtacaattggacac
gttgaccatggtaaaacaactttaactgctgctatcacaacagtacttcataagaaatct
ggtaaaggtacagctatggcgtacgatcaaattgatggtgctccagaagaacgcgagcgc
ggtatcacaatctctactgcacacgttgagtacgaaactgaaactcgtcactatgcacac
gttgactgcccaggacacgctgactatgttaaaaacatgatcactggtgctgcgcaaatg
gacggagctatccttgtagtatctgctgctgatggcccaatgccacaaactcgtgagcac
atccttctttctaaaaacgttggtgtaccatacatcgttgtattcttaaacaaatgcgac
atggtagacgacgaagagcttcttgaactagttgaaatggaagttcgcgatcttcttagc
gaatacgacttccctggtgatgatgtaccagttgttaaaggttctgctcttaaagctctt
gaaggagacgctgagtgggaagctaaaatcttcgaacttatggatgcggttgatgagtac
atcccaactccagaacgcgacactgaaaaaccattcatgatgccagttgaggacgtattc
tcaatcactggtcgtggtacagttgctactggccgtgtagaacgcggacaagttaaagtc
ggtgacgaagttgaaatcatcggtcttcaagaagagaacaagaaaacaactgttacaggt
gttgaaatgttccgtaagcttcttgattacgctgaagctggtgacaacattggtgccctt
cttcgcggtgtatctcgtgaagaaatccaacgtggtcaagtacttgctaaaccaggtaca
atcactccacacagcaaattcaaagctgaagtttacgttctttctaaagaagagggtgga
cgtcatactccattcttctctaactaccgtcctcagttctacttccgtacaactgacgta
actggtatcatccatcttccagaaggcgtagaaatggttatgcctggagataacactgaa
atgaacgttgaacttatttctacaatcgctatcgaagaaggaactcgtttctctattcgt
gaaggcggacgtactgttggttcaggcgttgtttctacaatcactgagtaa

DBGET integrated database retrieval system