KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_0188
Entry
A7A1_0188         CDS       T02384                                 

Definition
(GenBank) putative aspartate aminotransferase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00998  Biosynthesis of various secondary metabolites - part 2
bsl01100  Metabolic pathways
bsl01110  Biosynthesis of secondary metabolites
Module
bsl_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bsl00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    A7A1_0188
Enzymes [BR:bsl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     A7A1_0188
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: AGA20806
LinkDB
Position
337586..338785
AA seq 399 aa
MEITPSDVIKTLPRQEFSLVFQKVKELEKTGAHIINLGQGNPDLPTPPHIVEALREASLN
PSFHGYGPFRGYPFLKEAIAAFYKREYGVTINPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAELYEMPLYEENGYLPDFEKIDPAVLEKAKLMFLNYPNNPT
GAVADAAFYARAAAFAKEHNIHLIHDFAYGAFEFDQKPASFLEAEDAKIVGAELYSFSKT
FNMAGWRMAFAVGNERIIQAVNEFQDHVFVGMFGGLQQAASAALSGDPEHTESLKRIYKE
RIDFFTALCEKELGWKMEKPKGTFYVWAEIPNTFETSHQFSDYLLEHAHVVVTPGEIFGS
NGKRHVRISMVSKQEDLREFVMRIQKLNLPFGSLQETSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaataacaccgtccgatgtcatcaagacacttccaaggcaggagttttctctcgtt
tttcaaaaggtaaaggaattggaaaaaacgggggcccatatcattaatctcggacagggg
aaccctgaccttcccactccgccgcatattgtggaggctttgcgggaggcgtccttgaat
ccttcgtttcatggatacggcccattcagaggctatccttttttaaaggaagcgatcgct
gcgttctataaaagagaatacggcgtgacaatcaatcctgaaacggaggtcgcgcttttc
ggaggcgggaaagccggtttgtatgtgctgacacaatgcctgctcaatccgggagacatc
gctttagtcccgaatccaggctaccctgaatatttatcagggattacgatggcgcgagct
gagctttacgaaatgccgctgtatgaagaaaatggctatctgccggattttgaaaagatt
gatccagccgtgctggaaaaagcgaagcttatgtttttaaactatccgaacaatcccact
ggagctgtggctgatgcggctttttatgcaagagctgctgcttttgcgaaagagcataac
atccatttgattcatgattttgcatacggagcgtttgaattcgatcaaaaaccggccagt
tttcttgaggcagaggatgccaaaattgtcggagcagagctttattcattttcaaaaaca
tttaacatggccggctggagaatggcgtttgcggttgggaacgaaaggatcattcaggcc
gtcaatgaatttcaggatcatgtatttgtcggcatgttcggcgggctgcagcaggcagcg
agtgcggcgctttctggagatccggagcatacggaatcgttgaaacgaatttataaggaa
cgaattgacttttttacggcgctttgtgaaaaggaattgggctggaagatggaaaagcca
aaaggaaccttttacgtatgggctgaaattccgaatacgtttgagacatctcaccaattt
tccgattacttgctggagcatgcccatgtcgtagtcacaccgggcgaaatttttggaagc
aacggaaaaaggcatgtcagaatctcaatggtgtcgaagcaggaggatctgagggaattt
gtcatgcggattcaaaagctgaacctgccgttcgggtcattacaagaaacatcccgctaa

DBGET integrated database retrieval system