KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_0348
Entry
A7A1_0348         CDS       T02384                                 

Definition
(GenBank) Fructose-specific phosphotransferase enzyme IIA component (PTS system fructose-specific EIIA component; EIIA-Fru; p16)
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00051  Fructose and mannose metabolism
bsl02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A7A1_0348
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    A7A1_0348
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsl02000]
    A7A1_0348
Enzymes [BR:bsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     A7A1_0348
Transporters [BR:bsl02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    A7A1_0348
SSDB
Motif
Pfam: EIIA-man
Other DBs
NCBI-ProteinID: AGA20966
LinkDB
Position
1464148..1464588
AA seq 146 aa
MISVIISGHGDFPIALKESSGMIFGEENNLIAVPFFKGEGIQTLQEKYHQALKDIPEEHE
VLFLVDIFGGTPYNAAASFIAEDQRMDMAAGVNLPILLEVLSQREHLALKDLLNNLKAMS
QQSFQVCSEHLEKVKTANQDTREDEL
NT seq 441 nt   +upstreamnt  +downstreamnt
atgatttcagttattatcagcggtcatggagattttcccatagcattaaaagagtcttca
gggatgatattcggtgaagaaaataacctgattgcagtgccgttttttaaaggggaagga
atacaaacgctgcaagaaaaatatcatcaggcgctcaaggatatcccggaagaacatgaa
gtgctttttttagtcgatatttttggagggacgccatataacgcggcagcttcctttatt
gctgaggatcaaagaatggatatggcagccggcgtaaacctgccgattctgctggaggta
ttaagccagagagaacatctggctctcaaagatttgctgaacaacttaaaagcaatgagt
cagcaaagctttcaagtgtgcagtgaacatttagaaaaagtaaaaacagccaatcaagat
acaagagaggatgaattatga

DBGET integrated database retrieval system